3A4L


Conserved Protein Domain Family
selen_PSTK

?
TIGR03574: selen_PSTK 
Click on image for an interactive view with Cn3D
L-seryl-tRNA(Sec) kinase, archaeal
Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 132613
View PSSM: TIGR03574
Aligned: 6 rows
Threshold Bit Score: 312.504
Threshold Setting Gi: 146345494
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3A4L_A           6 LIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKE---KYEEFIKKSTYRLIDSALKN-YW-VIVDDT 80  Methanocaldoc...
Q58933           2 LIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKE---KYEEFIKKSTYRLIDSALKN-YW-VIVDDT 76  Methanocaldoc...
jgi:Maeo_0491    2 LIILTGLPGTGKSTFSKKLSKKLWEKGIDNIILGTDLIREQFPQWSN---EQEEFIKNSTDYLIKNALKD-YT-VIVDDT 76  Methanococcus...
Q6LX62           2 LIILTGLPSVGKSTFSKAFSKKMAEKNIDNIILGTDLIRESFPVWKE---SYEEFIRDSNNYLIKEALENkFS-VIVDDT 77  Methanococcus...
Q8TUS5           3 LLILTGPPGSGKTCFARELARELRQEGWRVAHVEADALRGFL--WDEfdpKLEQVARELFLKSVETCLDAeLDlVIADDT 80  Methanopyrus ...
jgi:Mevan_0799   2 IIILTGLPSVGKSTFSKTISKKMSEKNMDNIILGTDLLRESFPIWKE---SYEKYIRDSNTYLIKKALENkFS-VIVDDT 77  Methanococcus...
3A4L_A          81 NYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDF 160 Methanocaldoc...
Q58933          77 NYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDF 156 Methanocaldoc...
jgi:Maeo_0491   77 NYYNSKRRDLINIAKENNKNHIMIYLKAPLDTILKRNIQRGAKIPNEVIIDMFNKFDEPGTKYSWDKPDITIDTTKEINY 156 Methanococcus...
Q6LX62          78 NYYNSKRRDLMNIAKECDTNYVTIYLKAPLNLLLKRNIERGQKIPNEVIKNMYEKFDTPGTKYAWDLPDITVDTTEKIDY 157 Methanococcus...
Q8TUS5          81 NYYSSMRRELALLALERKVPWGIVYLRTGLDTCLRRNRERGEPIPEEVVRRIYDRFEPPEPDRWWERATLVLDDSR---- 156 Methanopyrus ...
jgi:Mevan_0799  78 NYYNSKRRDLINIAKSYDTVYITIYLKAPLNILLTRNVQRGQKIPNEVIKDMYEKFDTPGSKYSWDLPDIEIDTMKKINY 157 Methanococcus...
3A4L_A         161 NEIAKKLIEKSKE--IP-KFYVLEENKNKNNNISDKIDKETRKIVSEYIK----SKKLDKDKIKEVVELRKEFLKKIK-- 231 Methanocaldoc...
Q58933         157 NEIAKKLIEKSKE--IP-KFYVLEENKNKNNNISDKIDKETRKIVSEYIK----SKKLDKDKIKEVVELRKEFLKKIK-- 227 Methanocaldoc...
jgi:Maeo_0491  157 NKIVEKILEIKHNd-NK-PFKKEKKEITEKENIIYNIDKITRQIMGEYIK----THKLDKENIKKISELRKNYIKSIKnk 230 Methanococcus...
Q6LX62         158 NEILNEILEINENknLK-IEEDKIPKSEPVESDLVKIDSLTRNIVGNLIK----TGKIDKKDIKLLSEIRKSFLKDCKk- 231 Methanococcus...
Q8TUS5         157 --VSEEVLEFVESg-LR-VEKPKKRRRRTDPSSVNEVDVRTRQVMGELMRrlseTGAATQELGRKLSELRREIVSSVEdp 232 Methanopyrus ...
jgi:Mevan_0799 158 DEILNEILKISKFknLKaIKKLENPKMDFLENDLQKIDSMSRQIVGNLIK----TGKIDNKEIKKVSNIRKSFLKEFKs- 232 Methanococcus...
3A4L_A         232 -KMEEVDADRVLKEFKDLLN 250 Methanocaldococcus jannaschii
Q58933         228 -KMEEVDADRVLKEFKDLLN 246 Methanocaldococcus jannaschii DSM 2661
jgi:Maeo_0491  231 iDLDNYNINIVEKEFKKILN 250 Methanococcus aeolicus Nankai-3
Q6LX62         232 iESEKLDFEKIEKDFLDYLN 251 Methanococcus maripaludis S2
Q8TUS5         233 eKAVREFRRRAEEVIRECLH 252 Methanopyrus kandleri AV19
jgi:Mevan_0799 233 iEHEKINFKKIEEEFLIYLN 252 Methanococcus vannielii SB
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap