Conserved Protein Domain Family
WbuZ

?
TIGR03572: WbuZ 
glycosyl amidation-associated protein WbuZ
This clade of sequences is highly similar to the HisF protein, but generally represents the second HisF homolog in the genome where the other is an authentic HisF observed in the context of a complete histidine biosynthesis operon. The similarity between these WbuZ sequences and true HisFs is such that often the closest match by BLAST of a WbuZ is a HisF. Only by making a multiple sequence alignment is the homology relationship among the WbuZ sequences made apparent. WbuZ genes are invariably observed in the presence of a homolog of the HisH protein (designated WbuY) and a proposed N-acetyl sugar amidotransferase designated in WbuX in E. coli, IfnA in P. aeriginosa and PseA in C. jejuni. Similarly, this trio of genes is invariably found in the context of saccharide biosynthesis loci. It has been shown that the WbuYZ homologs are not essential components of the activity expressed by WbuX, leading to the proposal that these to proteins provide ammonium ions to the amidotransferase when these are in low concentration. WbuY (like HisH) is proposed to act as a glutaminase to release ammonium. In histidine biosynthesis this is also dispensible in the presence of exogenous ammonium ion. HisH and HisF form a complex such that the ammonium ion is passed directly to HisF where it is used in an amidation reaction causing a subsequent cleavage and cyclization. In the case of WbuYZ, the ammonium ion would be passed from WbuY to WbuZ. WbuZ, being non-essential and so similar to HisF that a sugar substrate is unlikely, would function instead as a amoonium channel to the WbuX protein which does the enzymatic work.
Statistics
?
PSSM-Id: 132611
View PSSM: TIGR03572
Aligned: 13 rows
Threshold Bit Score: 317.289
Threshold Setting Gi: 499462147
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011164164   1 MLRPRIIPCLLVK--------DGGLVK-TVKFKDPK--YVGDPINAVKIFN----EKRADELIVVDIDATVNGV--EPNY 63  Bdellovibrio ba...
WP_003113421   1 MVRRRVIPCLLLK--------DRGLVK-TVKFKEPK--YVGDPINAIRIFN----EKEVDELILLDIDASRLNQ--EPNY 63  Pseudomonas
WP_010946486   2 MSNVRLIARLDIK--------GPNLIK-GVHLEGLR--VVGNPNEYAMAYY----AQGADELIYMDTVASLYGR--NNLS 64  Legionella pneu...
WP_011398584   1 MLKKRIIPMLLLS--------QGRMVK-GKQFSAFR--DTGDPVSAARIYN----AQFADELVFLDVDANRQGSdfEQLL 65  Hahella chejuensis
WP_011315605   1 MLKKRLIPKFLLR--------DGRLVKyTCFFDNER--IAGNPVTTAKVYN----DYGVDELIVLDIVPSAASR--ARVE 64  Nitrobacter win...
WP_011171027   1 MYRNRIIPCLLLK--------DERLVK-TVKFKDPN--YIGDPLNAVRIFN----DKEADELFFIDISASKRE---SINF 62  Methanococcus m...
WP_002790574   1 MLKTRIIPCVLLK--------NGQLVK-SIEFKDFR--TIGHLTSTMRIYN----ARNVDELIILDIDASKSG---EIDF 62  Campylobacter
WP_011618161   1 MRNLRIIPRLDIK--------SGTLIK-GVQMEGWR--KVGDPILAAKRYS----EYGADELLFMDVVASLYER--NTLH 63  Synechococcus s...
WP_011129479   1 MLKKRLIPKLQFSikpsyrgpKPVLVI-TRQFDSKR--AIGDPVSQAKIYE----AQLADELVLVDLEGTSDSW--PILL 71  Prochlorococcus...
WP_011127310   1 MSKKRIIFVLLYC--------DGFFCL-SRNFKLQR---IGDFRWLQRNYNfnysATFIDELIILDISRKSRDI--NKFA 66  Synechococcus s...
WP_011415581   1 MRRLRIIPVLLLD--------GTSAVK-THQFKPAR--YIGDIVNAAQIFN----SKMADELIVVDIGYHQDN---PSRP 62  Erythrobacter l...
WP_011714041   1 MRRIRVIPTLLLK--------EGRLVK-TVRFNQAKatYVGDPVNTAKIFN----DKEVDELAVLDISASRRGA--EPDF 65  Magnetococcus m...
WP_011149292   4 MLKIRLIPCIVTK--------GELVVQ-SFAFKNYL--PIGNVKTAIDFFV----NWDVDEIIVNDIDASKEFR--EPNV 66  Vibrio vulnificus
WP_011164164  64 KMISNLAMECRMPLCYGGGVRTAAQAKKIVSLGVEKVAISAAALENMSLITQMAEEIGRQSVVVVLDVKKRLLGRtF-DV 142 Bdellovibrio ba...
WP_003113421  64 ELIAEVAGECFMPICYGGGIKTLEHAEKIFSLGVEKVSINTAALMDLSLIRRIADKFGSQSVVGSIDCRKGFWGG-H-SV 141 Pseudomonas
WP_010946486  65 EIVKTTAENVFIPITVGGGIRSVDDAKQLLRCGADKVAINTAATKNPTLISDIARRFGSQCVVLSIEAKRTVNGR-W-EV 142 Legionella pneu...
WP_011398584  66 NLIDKVSSECFMPLSVGGGVNSVEQVRRLVQSGADKVVITTAALENPGLINDASAIFGRQCIVVGLDVKRE--DGaY-RL 142 Hahella chejuensis
WP_011315605  65 DIIGRMSEEIFMPFTVGGGVKTAEDVNALLRAGADKVSINSEAVRRPEFVREAARTFGDQCITVSIDYKRI--GShHaSV 142 Nitrobacter win...
WP_011171027  63 DLLKKISSQSFMPLGYAGGIKCLNDAKKIFSIGFEKISLNTIVLKNPDLITEISKIYGSQSVLVTIDVKKNFFGK-Y-YV 140 Methanococcus m...
WP_002790574  63 ESIEDLAKECFMPLTMGGGIKTLEDIQKILNLGADKISINSKALEDMDFISKAANRFGSQCIVCSIDVKRK--GGqF-CV 139 Campylobacter
WP_011618161  64 EIVEQVCSNVFIPVTVGGGIRKIKDVETLLSRGADKVSVNTGALLKPELINEISDRYGSQATVLTVECLKCGEKS-W-EA 141 Synechococcus s...
WP_011129479  72 DTLSNMSESLATPLSVGGGITSFEQVQQLLDRGADKVVLNSGAVNNPQLIDLVANSYGSQCVVISIDIRKESDLSrH--V 149 Prochlorococcus...
WP_011127310  67 TLLYNLSENIFVPITAGGGIRSFEDAKVLFENGADKVCLNTSLIQCPHVSEKISSVYGQQSLVASIDFKHD--HGdF-KF 143 Synechococcus s...
WP_011415581  63 EVIRHLAEECFMPLAFGGGISSVDEAAALFKDGIEKVSINTAFVEGGALVEEAARQFGSQSVVASIDARREADGS-Y-QV 140 Erythrobacter l...
WP_011714041  66 ECVEQLASECFMPLLYGGGVRNLQQIQRLFHSGVEKVMLNTAFFSGSGLLQEAVKIYGSQSLGVSIDVKKDLWGR-Y-RV 143 Magnetococcus m...
WP_011149292  67 DLVSWAAKECFVPLTVGGGIKTLEHIRNLLKAGADKVTINTKAIDDPDFIKNAASVFGSQCITVSVDAIKQ--GNvY-KL 143 Vibrio vulnificus
WP_011164164 143 WTHNGTKNTKREFIEVAKEAEQLGAGEIVVNSIDDDGKMSGYDVALIKKLRESVKIPVTVLGGAGSLDDISKVIEECGTV 222 Bdellovibrio ba...
WP_003113421 142 FSENGTRDMKRSPLEWAQALEEAGVGEIFLNSIDRDGVQKGFDNALVENIASNVHVPVIACGGAGSIADLIDLFERTCVS 221 Pseudomonas
WP_010946486 143 MTDNGREHTGMDVVDWARNGEEFGAGEILLTSIDQEGTRKGFDLELVKQVSSMVSIPVIASGGMGKLEDLTEVVCESKAD 222 Legionella pneu...
WP_011398584 143 YSHCGRHKTERELEEFIRDMTQRGAGEFIVNAVDRDGMMQGYDLEMIKCAKAVTDRPVLAAGGAGTFAHLTAAFQEANAD 222 Hahella chejuensis
WP_011315605 143 YIDGGREHVALDPVEWALRCEDLHCGEILMSSIDRDGTMQGYDLEMINTLTKRLGVPMIVSGGCGSLQHAID-ALEAGAS 221 Nitrobacter win...
WP_011171027 141 YNHLKKKITKYNPVDFARKMEVLGAGELVINCVDNDGVMKGYNLKLIGEISKAVKIPIVALGGAGSLKDLDD-AINVGAS 219 Methanococcus m...
WP_002790574 140 YDRGNL--LEKSPLELALEYEKKGAGELLLTSVDFEGRAKGYDLELLKIFQNKLKIPLIINGGLSNPSDGVE-ALNLGAD 216 Campylobacter
WP_011618161 142 LTDNGRNRSGREVIEWVKEAENRGAGEIVLTSIDQDGRGYGFDIDLVDIVSQAVNIPIIASGGFGKPSHIVELIKSTDVS 221 Synechococcus s...
WP_011129479 150 YIDGGSTATDWSLFSWANDCASRGAGELLITSIDNDGTGTGLDLDSIRQLRYEVNLPLIASGGCGLAQHFVAGY-EVGAS 228 Prochlorococcus...
WP_011127310 144 FIDNGLIEVQYNIQELISFLDPLPFCEILLQSVDRDGTGTGFDLTLANTFRDQLSKPIILLGGAGHSDHLVEGLLHQSTD 223 Synechococcus s...
WP_011415581 141 YSRGGTRALGIDPVEMARRAEAQGAGEILIQSIDRDGMRKGYDRNLVRSIVDATTLPVVALGGADTVDDLAQVILRDgas 220 Erythrobacter l...
WP_011714041 144 MSQGGQRKTGLDPVVAAQQAEQAGAGELLLNAMDQDGMQQGYDLELVQRVSRGVAIPVIAVGGAASVADFRTVVTQAGAA 223 Magnetococcus m...
WP_011149292 144 YDYRDGRVLDVDVVDWVRKVESYGAGEILLNSVDRDGSREGYDVELLKTVSGIVSIPVIALGGIGRFDQLAEGAIEGGCQ 223 Vibrio vulnificus
WP_011164164 223 GVAAGSLFVF 232 Bdellovibrio bacteriovorus
WP_003113421 222 AVAAGSLFVF 231 Pseudomonas
WP_010946486 223 AVAMADVLHY 232 Legionella pneumophila
WP_011398584 223 AVVCASIFHF 232 Hahella chejuensis
WP_011315605 222 AVAISSMFLF 231 Nitrobacter winogradskyi
WP_011171027 220 AAGAGSLFIY 229 Methanococcus maripaludis
WP_002790574 217 ALAGAYIFHF 226 Campylobacter
WP_011618161 222 GAAIAQALHW 231 Synechococcus sp. CC9311
WP_011129479 229 AVAAGTFFSQ 238 Prochlorococcus marinus
WP_011127310 224 AVATAHLLNF 233 Synechococcus sp. WH 8102
WP_011415581 221 aaaagsmfaf 230 Erythrobacter litoralis
WP_011714041 224 AVAAGSMFVF 233 Magnetococcus marinus
WP_011149292 224 ALSAANIFQH 233 Vibrio vulnificus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap