Conserved Protein Domain Family
perox_SACOL1771

?
TIGR03563: perox_SACOL1771 
peroxiredoxin, SACOL1771 subfamily
This protein family belongs to the OsmC/Ohr family (pfam02566, OsmC-like protein) of peroxiredoxins.
Statistics
?
PSSM-Id: 132602
View PSSM: TIGR03563
Aligned: 7 rows
Threshold Bit Score: 210.402
Threshold Setting Gi: 488413635
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011067431   4 HHFYLKAEWPGGRNSQGTIDAGNLKTKISIPTEMDGPGIGSNPDEMLLGAAATCYVITLAAMIERAELPLSKMSLESEGI 83  Oceanobacillus ...
WP_003245175   4 HHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSGLEKEDLQMESEGI 83  Bacillales
WP_003182035   4 HHFYLQADWPGKRNDIGRIESGNLKTEISIPKEMDGPGAGTNPDEMLLGAAATCYIITLAAMMERSGLEKESLTMESEAV 83  Bacillus
WP_011246961   3 HQFLLDATWNGGRNSTGTIQTGNLSHSISIPKEMGGPGIGTNPDEMLLGAAATCFLITYAAMLERAQIEVESLTLHAEAD 82  Bacillus clausii
WP_011275502   4 HDFKVQTKWRGGREEVGTVNGDIISEQISIPAPLGGNGVGTNPDELLVSAASSCYIISLAATLERAKFTDINLINNSVGT 83  Staphylococcus ...
WP_003131602   4 HLFNSHIDWVGGRNSIGDLQAGALNEKISIPKTMDGPGVGTNPDEMLLGAASTCYSITLAAMLERNDILLEHLKVDAKGI 83  Lactococcus lactis
WP_002483020  58 HEFKVQTNWNGGRDTVGNLQGDILEEQISIPSGLGGNGTGTNPDELLVSAASSCYIISLAAVLERSGFTDIKIAQSSIGT 137 Staphylococcus ...
WP_011067431  84 VDVTNGVFTYEKIIHKPFVDLKNEASDKQWNHVRKLVEKAETSCMISRAIQGNVQIEL 141 Oceanobacillus iheyensis
WP_003245175  84 VNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQL 141 Bacillales
WP_003182035  84 VDVTGGVFTYEKIIHRPLIRLPKEAAQKEAELAERLAKKAETSCMISRAVQGNVAIEL 141 Bacillus
WP_011246961  83 VDVTNNIFEFRAIRHFPTVVLKE---QTQLEKAERLAFKAESSCMITKAVAGNVAVSV 137 Bacillus clausii
WP_011275502  84 ALFENGKFKMVTITHYPKISVTAEDKENLEKRLPKLLEIADNNCMISNSIRNNVEIKI 141 Staphylococcus haemolyticus
WP_003131602  84 VDVTKGTFTYEKITYHVAMKLTKE---SDEVKAIKLAKRAESSCMISRAIQGNIELET 138 Lactococcus lactis
WP_002483020 138 AIFENAKFRMDNIVHYPEIYVSQEQKDNLTKKLPKLLKVADNNCMISNSLRGNVEVKI 195 Staphylococcus saprophyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap