1EZW,1Z69,1F07


Conserved Protein Domain Family
F420_mer

?
TIGR03555: F420_mer 
Click on image for an interactive view with Cn3D
5,10-methylenetetrahydromethanopterin reductase
Members of this protein family are 5,10-methylenetetrahydromethanopterin reductase, an F420-dependent enzyme of methanogenesis. It is restricted to the Archaea. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132594
View PSSM: TIGR03555
Aligned: 8 rows
Threshold Bit Score: 557.904
Threshold Setting Gi: 13787047
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EZW_A   6 FGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDW 85  Methanopyrus kandleri
Q58929   3 FGIEFVPNEPIQKLCYYVKLAEDNGFEYCWITDHYNNRNVYMALTAIAMNTNKIKLGPGVTNPYVRSPAITASAIATLDE 82  Methanocaldococcus ja...
O27784   3 FGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDE 82  Methanothermobacter t...
O29196   3 FGIEFVPDMKYYELEYYVKLAEDSGFDYTWITDHYNNRNVYSMLTILALKTRTIKLGPGVTNPYHISPALTASAIGTINE 82  Archaeoglobus fulgidu...
Q8TJP7   3 FGIEFVPSDPALKIAYYAKLSEQQGFDYVWITDHYNNRDVYSTLTVLALNTNSIKIGSGVTNSYTRNPAITASSIASIAE 82  Methanosarcina acetiv...
Q8TXY4   6 FGIELLPDDKPTKIAHLIKVAEDNGFEYAWICDHYNNYSYMGVLTLAAVITSKIKLGPGITNPYTRHPLITASNIATLDW 85  Methanopyrus kandleri...
1Z69_A   3 FGIEFVPSDPALKIAYYAKLSEQQGFDHVWITDHYNNRDVYSTLTVLALNTNSIKIGPGVTNSYTRNPAITASSIASIAE 82  Methanosarcina barkeri
1F07_A   3 FGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDE 82  Methanothermobacter m...
1EZW_A  86 ISGGRAIIGMGPGDKATFDKMGLPFpckipiwnpeaedeVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVKARS 165 Methanopyrus kandleri
Q58929  83 LSGGRAVLGIGPGDKATFDALGIEW--------------VKPVTTLKESIEVIRKLLAGERVSYEGKVVKIAGAALAVKP 148 Methanocaldococcus ja...
O27784  83 LSNGRATLGIGPGDKATFDALGIEW--------------VKPVSTIRDAIAMMRTLLAGEKTESGAQL-------MGVKA 141 Methanothermobacter t...
O29196  83 ISGGRAVLGIGAGDKVTFERIGITW--------------EKPLKRMREAVEIIRQLTEGKAVKYDGEIFKFNGAKLGFKP 148 Archaeoglobus fulgidu...
Q8TJP7  83 ISGGRAVLGLGPGDKATFDAMGIAW--------------EKPLATTKEAIQAIRDFIAGKKVSMDGEMVKFAGAKLAFKA 148 Methanosarcina acetiv...
Q8TXY4  86 ISGGRAIIGMGPGDKATFDKMGLPFpckipiwnpeaedeVGPATAIREVKEVIYQYLEGGPVEYEGKYVKTGTADVNARS 165 Methanopyrus kandleri...
1Z69_A  83 ISGGRAVLGLGPGDKATFDAMGIAW--------------KKPLATTKEAIQAIRDFISGKKVSMDGEMIKFAGAKLAFKA 148 Methanosarcina barkeri
1F07_A  83 LSNGRATLGIGPGDKATFDALGIEW--------------VKPVSTIRDAIAMMRTLLAGEKTESGAQL-------MGVKA 141 Methanothermobacter m...
1EZW_A 166 IQGSdIPFYMGAQGPIMLKTAGEIANGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEAT 245 Methanopyrus kandleri
Q58929 149 IQKA-VPVYMGAQGPKMLETAGMIADGVLINASNPKDFEAAIPLIKKGAEAAGRSMDEIDVAAYACMSVDKNADKAKQAA 227 Methanocaldococcus ja...
O27784 142 VQEK-IPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAESAGKSLSDIDVAAYTCCSIDEDSAAAANAA 220 Methanothermobacter t...
O29196 149 --GS-IPIYIGAQGPKMLQLAAELGDGVLINASHPKDFEVAKENIDAGLAKAGKSRDAFDTVAYASMSVDKDRDKARNAA 225 Archaeoglobus fulgidu...
Q8TJP7 149 --GN-VPIYMGAQGPKMLELAGEVADGVLINASHPKDFEVAVEQIRKGAEKVGRDPSEVDVTAYACFSIDKDPAKAINAA 225 Methanosarcina acetiv...
Q8TXY4 166 IQGSdIPFYMGAQGPIMLKTAGEIADGVLVNASNPKDFEVAVPKIEEGAKEAGRSLDEIDVAAYTCFSIDKDEDKAIEAT 245 Methanopyrus kandleri...
1Z69_A 149 --GN-IPIYMGAQGPKMLELAGEIADGVLINASHPKDFEVAVEQIKKGAEKAGRDPSEVDVTAYACFSIDKDPVKAVNAA 225 Methanosarcina barkeri
1F07_A 142 VQEK-IPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAEAAGKSIADIDVAAYTCCSIDEDAAAAANAA 220 Methanothermobacter m...
1EZW_A 246 KIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIG----KGDFGTAI-G-LVDEDMIEAFSIAGDPDTVVDKIEELLKAGV 319 Methanopyrus kandleri
Q58929 228 VPVVAFIAAGSPPVVLERHGIDMEKVEAIRNALK----SGNFPEAF-K-NVDDTMLEAFSIYGTPEDVVEKCKKLAEMGV 301 Methanocaldococcus ja...
O27784 221 KIVVAFIAAGSPPPVFERHGLPADTGAKFGELLG----KGDFGGAI-G-AVDDALMEAFSVVGTPDEFIPKIEALGEMGV 294 Methanothermobacter t...
O29196 226 RIVVAFIVAGSPPTVLERHGLSEDAVNAVREALNnaftKGDWGGVA-K-SVTDEMIDIFSISGTPDDVIERINELSKAGV 303 Archaeoglobus fulgidu...
Q8TJP7 226 KVVVAFIVAGSPDLVLERHGIPVDAKKQIGDAIA----KGDFGALM-GgLVTPQMIEAFAICGTPEDCMKRIKDLEAIGV 300 Methanosarcina acetiv...
Q8TXY4 246 KIVVAFIVMGSPDVVLERHGIDTEKAEQIAEAIG----KGDFGTAI-G-LVDEDMIEAFSIAGDPDTVVDKIEELLKAGV 319 Methanopyrus kandleri...
1Z69_A 226 KVVVAFIVAGSPDLVLERHGIPVEAKSQIGAAIA----KGDFGALMgG-LVTPQMIEAFSICGTPDDCMKRIKDLEAIGV 300 Methanosarcina barkeri
1F07_A 221 KIVVAFIAAGSPPPVFERHGLPADTGKKFGELLG----KGDFGGAI-G-AVDDALMEAFSVVGTPDEFIPKIEALGEMGV 294 Methanothermobacter m...
1EZW_A 320 TQVVVGSPIGPDKEKAIELVGQEVIP 345 Methanopyrus kandleri
Q58929 302 TQIVAGSPIGPNKETAIKLIGKKVIP 327 Methanocaldococcus jannaschii DSM 2661
O27784 295 TQYVAGSPIGPDKEKSIKLLG-EVIA 319 Methanothermobacter thermautotrophicus str. Delta H
O29196 304 TQVVAGSPIGPDKKKSIQLIGKEIIP 329 Archaeoglobus fulgidus DSM 4304
Q8TJP7 301 TQIVAGSPIGPEKEKAIKLIGKEIIA 326 Methanosarcina acetivorans C2A
Q8TXY4 320 TQVVVGSPIGPDKEKAIELVGQEVIP 345 Methanopyrus kandleri AV19
1Z69_A 301 TQIVAGSPIGPAKEKAIKLIGKEIIA 326 Methanosarcina barkeri
1F07_A 295 TQYVAGSPIGPDKEKSIKLLG-EVIA 319 Methanothermobacter marburgensis str. Marburg
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap