Conserved Protein Domain Family
F420_FbiB_CTERM

?
TIGR03553: F420_FbiB_CTERM 
F420 biosynthesis protein FbiB, C-terminal domain
Coenzyme F420 differs between the Archaea and the Actinobacteria, where the numbers of glutamate residues attached are 2 (Archaea) or 5-6 (Mycobacterium). The enzyme in the Archaea is homologous to the N-terminal domain of FbiB from Mycobacterium bovis, and is responsible for glutamate ligation. Therefore it seems likely that the C-terminal domain of FbiB modeled here, is involved in additional glutamate ligation. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132592
View PSSM: TIGR03553
Aligned: 8 rows
Threshold Bit Score: 241.232
Threshold Setting Gi: 499921726
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011727937 258 QAQLLRRSVRRFSAEPVPHDAIEAAVGEALTAPAPHHTRPVRFVWVQDSETRTRLLDRMKEQWRADLTADGLDADAVDRR 337 Mycobacterium s...
WP_011558734 262 EAQLLRRSIRRFSADPVAPEMIEAAVAEALTAPAPHHTRPVRFVWVGDHATRIRLLDRMKDRWRDDLLADGLSADAVERR 341 Mycobacterium
WP_017352016  49 QAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHTRPTRFVWLQTPAIRARLLDRMKDKWRSDLTSDGLPADAIERR 128 Mycobacterium t...
WP_011211155 259 EAVLLRRSVRTFADTPVEPDTIRAAVSVALTAPAPHHTRPVRFVWVRDAQRRQRLLAAMADKWRADLRADGLDPERIERR 338 Nocardia farcinica
WP_011598255 261 EAVLLRRSVRHFATDPVDPDAVRASIADALTAPAPHHTRPVRFVWIRTRTVRDALLTRMREQWRTDLAADAMSADAIDTR 340 Rhodococcus
WP_011292941 230 DVIHARRTIREFTDDPVDPEAVRRAVAAAITAPAPHHTTPWRFVLLESADERTRLLDAMAEAWVADLRADGLSEERIARR 309 Thermobifida fusca
WP_011028727 250 QAVTQRRTVRAFTDEPVDPGAVRRAVAAAVTAPAPHHTTPWRFVLLESGESRTRLLDAMRDAWIADLRRDGKSEESVAKR 329 Streptomyces co...
WP_011602460 240 AALSERRTVREFSAAPVDPAAVERAVAAALTAPAPHHTTPWRFVLV--TERRAELLAAMAAAWAEDLRRDGFDEAAVDRR 317 Frankia alni
WP_011727937 338 VARGQILYDAPELVIPFLVPDGAHSYPDDARTAAEHTMFTVAVGAAVQGLLVALAVRDIGSCWIGSTIFAADLVRAELEL 417 Mycobacterium s...
WP_011558734 342 LARGQILYDAPELVIPFLVPDGAHDYPDDTRTAAEHTMFTVAVGAAVQAFLVALAVREVGSCWVGSTIFAADVVRAELDL 421 Mycobacterium
WP_017352016 129 VARGQILYDAPEVVIPMLVPDGAHSYPDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGSTIFAADLVRDELDL 208 Mycobacterium t...
WP_011211155 339 VGRGRILFDAPEVLIPCCVPDGAHSYPDERRQAAETTMFTVAVGAAVQGLLVALATEGVGSCWIGSTIFAPEVTRAELDL 418 Nocardia farcinica
WP_011598255 341 VARGNILLDAPEVIIPFCVPDGAHHYPDQRRRAAESTMFTVAVGAAVQGLLVSLATKGIGSCWIGSTIFAPDTVRGTLDL 420 Rhodococcus
WP_011292941 310 IRRGDVLRRAPYLIVPCLVAEGAHSYPDERRASAERAMFLVAMGAGVQNLLLALTVEGLGSAWVSSTMFCPDVVREVLKL 389 Thermobifida fusca
WP_011028727 330 VRRGDVLRNAPYLVVPCLVMDGSHTYGDVRRDAAEREMFVVATGAGVQNLLVALAGERLGSAWVSSTMFCRDVVREVLGL 409 Streptomyces co...
WP_011602460 318 LRRGDVLRRAPLLVVPVMVLDGAHPYPDARRAAAEERMFTVAVGAGVQNLLVALATEGLGSCWVSSTLFCAEVVGAVLDL 397 Frankia alni
WP_011727937 418 PDDWEPLGAIAIGYPeqtPQPLGPRDPVPTDELLVRK 454 Mycobacterium smegmatis
WP_011558734 422 PAEWEPLGAVAVGHP---AEPQGPRDPVLPEGLLVRR 455 Mycobacterium
WP_017352016 209 PVDWEPLGAIAIGYA---DEPSGLRDPVPAADLLILK 242 Mycobacterium tuberculosis
WP_011211155 419 PADWNPLGAIAVGYP---TEELAPRPPRDPGDGLVER 452 Nocardia farcinica
WP_011598255 421 PADWQPLGAIAVGHP---LEPLTPRHAADPGDALIER 454 Rhodococcus
WP_011292941 390 PEDWQPMGAVAVGHP---AAPPKHRPPRDPEAFIEVR 423 Thermobifida fusca
WP_011028727 410 PDGWDPMGAVAVGHP---AEEPKARPERDAEAFIEVR 443 Streptomyces coelicolor
WP_011602460 398 PAGWVPMGAVGVGHA---AAPPTPRAPRDPEPFLLRR 431 Frankia alni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap