Conserved Protein Domain Family
F420_cofH

?
TIGR03551: F420_cofH 
7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit
This enzyme, together with CofG, complete the biosynthesis of 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, the chromophore of coenzyme F420. The chromophore is also used in cyanobacteria DNA photolyases. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132590
View PSSM: TIGR03551
Aligned: 20 rows
Threshold Bit Score: 524.919
Threshold Setting Gi: 499725259
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011563960 433 LGEAEIALLFTAR-GtELHELCRVADELRREVNGEAVTYVVNRNINYTNMCYFRCRFCAFSKGPRSlnlrGEPYLLDEAE 511 Rubrobacter xyl...
WP_011019265  22 IDEGTALDALQGK-L-DPYKVMRAAHEARLKIVGEHVTFVVNRNINFTNVCINRCRFCAFRRDPDD----PDAYRMTPEE 95  Methanopyrus ka...
WP_010876455  55 ITKEEALYLMGVTgR-DLQALMIAADMVREAEAGDRITYIENWNINFTNICSGQCGFCAFKRDAAD----GDSYYLETER 129 Methanothermoba...
WP_011021504  18 CTKEDALQLLE---V-PPFELFRFADELRDLAVGDTVTYVVNRNINFTSRCVGTCGFCAFRTNNG--------KVLSIEE 85  Methanosarcina ...
WP_011308329  21 CTKEDALLLLE---G-NPFELFELANDLRASTVGDAVSYVVNRNIYITNKCVGNCGFCAYRTEKG--------YILSVEE 88  Methanosarcina ...
WP_010878301   1 -mlmvmLALDDLL-K-NPYETFRIADELRRELVGDTVTYVVNRNINFTDICINDCKFCSFRNRKK--------YLLSLDE 69  Archaeoglobus f...
WP_011499367  16 aTKEDAFELL--D-V-NPFELFTLANNLRKEAVGDTVTYVNNKNIYITNMCKGNCGFCGFREEKG--------YILTIEE 83  Methanococcoide...
WP_011499366  15 tTKEDALTLLE---I-EPFELFELADQIRAKAVGDNVTYIVNRNINFTDICIGTCGFCAFKDKKG--------YLLSIDQ 82  Methanococcoide...
WP_011170001  11 ISKKDCVELFEDT-E-NFFDILKLADSIRKDIVGDTVTFVKNTNIETTNVCTMGCKFCAFSVSKNS----PEAFKLDADE 84  Methanococcus m...
WP_011405993  14 ITKEDAIELVRS--A-NQFELFDTADKLRQTIVGDKVTYVVNKAIDITDNCMIGCKFCSFRNFEN--------YKMTNEE 82  Methanosphaera ...
WP_011563960 512 VARRAREAWERGATEVCMQGGIHGRFTGENYLRYLRAVKE---AVPGMHVHAFSPLEVRQGAQTLGLTVEEFLRELKEAG 588 Rubrobacter xyl...
WP_011019265  96 VGERAAEARDAGATEVCLQGGLHPEATFEYYLEMLDEIKS---QAPDIHVHGYSPMEVKYCAKLAGEDIEDVLRELKRAG 172 Methanopyrus ka...
WP_010876455 130 ILEIAAEAIEKGARELCIQGGLYPGLDTYFYEDLIRAIKS---EFPDVHLHSFSPMEVYYGAQNAELTVEEALKILKRAG 206 Methanothermoba...
WP_011021504  86 IMEKVRDAEKANATEVCIQGGLLPEVGLDFYQGIAEAIKA---EFPEMHIHSFSPMEVYHASRISEIPVKEALRRLKRSG 162 Methanosarcina ...
WP_011308329  89 ILEKAGEARKAGAVEVCIQGGYIPEADIEFYLEIIESVKA---EFPDLCIHALSPMEVNYAAGLSGMSVEEALHRLKKSG 165 Methanosarcina ...
WP_010878301  70 IKQKVEEAVEFGCTELCIQGGLLPDADLDFYLSILQAVRD---VDKKIHIHAFSPMEVVHAARNSGMTVEEVLKELKKEG 146 Archaeoglobus f...
WP_011499367  84 ILEQVGQAEKAGAVEICIQGGYLPQLDLEFYNDIVKSIHT---KYPNMTIHGFSPMEIYYASSLSKTPIEDAFSELKKSG 160 Methanococcoide...
WP_011499366  83 IKDKIKEAHVSGATEVCIQGGLLPNVKIDLYIDILKAVKS---DYPHIHTHCFSPMEVNHAAKASGLSVEETLKTLKANG 159 Methanococcoide...
WP_011170001  85 IAKKAVIAKKSGLTEVTIHGGIHPDVDTHFQVETINKVNSatsKLGGIYTHAYSPQEILNGAENAGLSIKEALKMLNEAG 164 Methanococcus m...
WP_011405993  83 ISESIVQAKTVGATEICLFGGITRDMDIDYYCNLIENIKN---Q-HEICLHALSPAEIYQTAKNSNITTFEALSRLKDVG 158 Methanosphaera ...
WP_011563960 589 LGTLPGTAAEILDDGIRAIICPDKLSTGEWAGVMRAAHSLGLRSTATVMYGHVEAPAHWARHLTVLRGIQAETGGFTEFV 668 Rubrobacter xyl...
WP_011019265 173 LDSMPGTAAEIFSPEVRKRLCPDKLEADEWEHIIRIAHELGIPTTCTMMYGHIDSPRDWIDHMKRLRGIQEDTGGFTEFV 252 Methanopyrus ka...
WP_010876455 207 LGSMPGTAAEILDDDVRAVICPTKLSTGEWVEVIETAHRVGIPTTCTMMYGHIDGPEHRVEHMDILRRIQEKTGGFTEFV 286 Methanothermoba...
WP_011021504 163 LDTMPGTAAEILSDRVRKIICPSKLKTAEWVEVVRQAHAAGIPTTATMMYGHVETREERIDHMLIIRDIQKETGGITEFV 242 Methanosarcina ...
WP_011308329 166 LDSLTGTSAEILSDRVRKIICPGKINTQQWIDTITAAHKAGISTNSTIMYGHVETLEERLDHVFIIREIQKETGGFTELI 245 Methanosarcina ...
WP_010878301 147 LGSMPGTAAEILDDSIRALICPRKLKTAEWVEVIKTAHRVGIPTTATIMYGHIDTWEHRINHLLLIKKIQQETGGITELI 226 Archaeoglobus f...
WP_011499367 161 LGTLTGTSAEILVDRVRKIICEDKITTDQWIETIKASHRVGLRTNATIMYGHVETWEERFDHILTIRSIQEETGAFTELI 240 Methanococcoide...
WP_011499366 160 LNTMPGTAAEILVDKVRNIICPDKLTRQEWIDTVTLAHKLGIQTTATMMYGHVDTWEDRIEHILTIRRIQKDTGGFSEFV 239 Methanococcoide...
WP_011170001 165 LRTIPGTAAEILDDEVRSDICPLKMSTKKWIDIMKTAHKTGIKTTSTIIYGHVEEYKHIVDHLSILKELQEETGGITEFI 244 Methanococcus m...
WP_011405993 159 MDTMTGASAEILVDSIRKQICPNKVSTADWAKIVKEAHELGIPTTSTIMYGSIETWEDRIEHMFLLKEIQEETHGFTEFV 238 Methanosphaera ...
WP_011563960 669 PLPFVHMGAPLFLQGRSRRG---PTFAEAVKMHAVGRIALHGYIDNVQVSWVKMGEEGVKVCLQAGCNDLGGTLMDENIS 745 Rubrobacter xyl...
WP_011019265 253 PLSFVHSNAPIYRRGGARPG---VSGMTDVLVHAVARLYFGPLIPNIQASWVKLGVKLAQMTLHAGANDLGGTLMEENIS 329 Methanopyrus ka...
WP_010876455 287 PLPFMHPHAPIYREGLAMPG---ATGADDLKVYAISRLMFRGLIENIQASWVKLGFKFAQVALLSGANDIGGTLGEENIS 363 Methanothermoba...
WP_011021504 243 PLPFMPYNNPVGEK-MIREGryaTPGLEDLKIYAVSRILFHGHVDNIQASWVKLGKKLAQFSLHCGTNDLGGTLMEESIS 321 Methanosarcina ...
WP_011308329 246 PMAFLPYNNPIGEK-MIASGkfsTTGLEDLQLIAISRVILHTYVKNIQATWVKLGKKLAQVALQCGANDLGGTLMEDQIS 324 Methanosarcina ...
WP_010878301 227 PLPFMSKNNEL---GRYAKG---SSGFDDLLMIAIARILLYPEIKNIQASWVKMGQKLAQAALHVGANDLGGTLMEENIS 300 Archaeoglobus f...
WP_011499367 241 TMPFMPYNNRVGEK-MLRSGkfmTTGMEDLKLIAIARVLLNTHVDNLQACWVKLGKKLAQVALSCGANDLGGTLMEDQIT 319 Methanococcoide...
WP_011499366 240 PLSFMPYNNPIGEK-MMEEGrfmNTGIDDLKIYAIARILLNTHINNIQTSWVKLGKKLAQMALYCGANDMGGTLMEESIS 318 Methanococcoide...
WP_011170001 245 PMSFLHENTPLYKSGRVTDG---ASGLYELKLYAIARILFKESIKNIQAPRVKIGTKLSQLILKSGANDLGGTLVEDKVS 321 Methanococcus m...
WP_011405993 239 PMTFLGENNEL---GKISNG---ATGIEDLKIHAISRIIFGDVIPNIQVSWVKLGLRMTQVALTCGANDIGGTMIEDKIS 312 Methanosphaera ...
WP_011563960 746 RAAGASHGQEMLPEELERIVREIGRTPRQRTTLYG 780 Rubrobacter xylanophilus
WP_011019265 330 REAGATEGEQLEPEEIVEIIREAGFTPVQRTTLYE 364 Methanopyrus kandleri
WP_010876455 364 KSAGASHGVRTEPEEIIRVVRDIGRIPARRDTLYR 398 Methanothermobacter thermautotrophicus
WP_011021504 322 RSAGACHGEMITVDELEWMIHGAGRIPKERTTLYR 356 Methanosarcina acetivorans
WP_011308329 325 TASGGSNGEYVSPAEFEWMIKGAGRTPMQRDTLYR 359 Methanosarcina barkeri
WP_010878301 301 KSAGATSGEFMHPEELRELIKIAGRVPKQRDTLYN 335 Archaeoglobus fulgidus
WP_011499367 320 LASGGANGEYLSPKELEWIITNADRKPMRRNALYE 354 Methanococcoides burtonii
WP_011499366 319 SSAGASSGEAISAEELEWIIRATDRKPVQRDTLYR 353 Methanococcoides burtonii
WP_011170001 322 KAAGSIY-EDASVDLMKNAITSIGRIPKERTTLYE 355 Methanococcus maripaludis
WP_011405993 313 TAAGGGYGGYLPVEKIKQLIKDIGRIPQERTTKYE 347 Methanosphaera stadtmanae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap