Conserved Protein Domain Family
F420_cofG

?
TIGR03550: F420_cofG 
7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit
This model represents either a subunit or a domain, depending on whether or not the genes are fused, of a bifunctional protein that completes the synthesis of 7,8-didemethyl-8-hydroxy-5-deazariboflavin, or FO. FO is the chromophore of coenzyme F(420), involved in methanogenesis in methanogenic archaea but found in certain other lineages as well. The chromophore also occurs as a cofactor in DNA photolyases in Cyanobacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132589
View PSSM: TIGR03550
Aligned: 20 rows
Threshold Bit Score: 513.764
Threshold Setting Gi: 499180760
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003896522  38 SYSRKVFIPVTHLCRDTCHYCTFVTVPGKLRAQgmgmYMEPDEILDVARQGAELGCKEALFTLGDRPEDRWEEARQWLDE 117 Mycobacterium s...
Q57888        36 TYSKNVFIPLSKWCRNKCGYCIFREDKPS--------LMKPNEVKEILLKGDRLGCREALFTFGEHVDEN-KEIKEQLKS 106 Methanocaldococ...
WP_011170820  36 TFSKNAFIPVCNWCRNVCGYCTFRNENFK--------LLKMDEMKEILTKADTFGCREALFTFGENVDEN-EKVKEELKK 106 Methanococcus m...
WP_010876822  33 TYSRNIFIPLTRACRNRCGYCTFRSDTPEP--P----LLEPEDVMGEVRRALSLGCTEALFTFGEDAHE-FPGVRDKLES 105 Methanothermoba...
WP_011405906  40 tYSRNIFLPLTHICQNNCGYCTFKQTPQEADFL----LMDKVEVLSTIKKSMKYGCTEALFTFGESADKN-ELIQEKLSR 114 Methanosphaera ...
WP_011448274   6 TYSRNVFVPLTFVCRNICGYCIFRRPPGEGC------VLSPDEVIRVLRRGAEAGCTEALFTFGEHPEEV-AGFMPFLEQ 78  Methanospirillu...
WP_011308327   2 TYSKNVFVPVTNICRNRCGYCGFRREPGQPGAR----LMKPEEILPVLENGAKAGCTEALFTFGEYAEEV-SEYRKWLKK 76  Methanosarcina ...
WP_011499365   6 TFSRNVFIPVTNICRNLCGYCTFRRDAGHPEAH----LMSMSEIRPILERGEKAGCTEALFVFGEYAEEV-PEYLLELEK 80  Methanococcoide...
AAG20121      45 TFARNVFVPLTTACRYTCTYCTYYDVPGEAS------LLTPEEIREQCRVGADAGCTEALFTFGDQPDDRYTAIHEQLGE 118 Halobacterium s...
WP_011322916  36 SFCRNVFVPLTTACRYTCTYCTYYEPPGQAS------LLSPAEIRDICERGADAGCTEALFTFGDDPDDRYERIHGQLAE 109 Natronomonas ph...
WP_003896522 118 RGYDSTLDYVRAMAIRVLEETGLLPHLNPGVMSWSELSRLKPVAPSMGMMLETTSRRLfeTKGEAHYGSPDKDPAVRLRT 197 Mycobacterium s...
Q57888       107 MGYDNILEYLYDLEEWTLNNTSLLPHTNCGILNYDELKMLKDVNASMGLMLENASERL--MNTIAHKHSPGKHPKLRIEM 184 Methanocaldococ...
WP_011170820 107 MGYSGILEYLYEISAWCLENTNLIPHTNCGILSYDELKYLREVNASMGLMLENSSARL--CGTIAHEKSPGKDPKLRIEM 184 Methanococcus m...
WP_010876822 106 LGFGDMTDYTYHLCELTL-DAGLLPHTNMGVIGYRELRMLKEVNASMGLMLESASPRL--METEAHRESPGKNPRLRIKM 182 Methanothermoba...
WP_011405906 115 YNYESMVDYLYDLSKEALNNYNILPHTNMGIISRDELYKLSQVNASMGLMLETTNEKL--LKTIVHRDSPGKNPKKRIEF 192 Methanosphaera ...
WP_011448274  79 YGFGSILEYCHAMAEEALR-LGLLPHTNAGIMTADEMSYLADVNASMGLMLETTADI------PAHRNCPGKEPARRIAM 151 Methanospirillu...
WP_011308327  77 LGYSSTLEYLLFLCEASI-DIGILPHTNAGIMTRTELKALKPLNASMGLMLESTATL------DAHKDCPGKLPELRLNT 149 Methanosarcina ...
WP_011499365  81 LGYSTTVEYVADLCKLAI-EIGLLPHTNAGILNRKELEILKPLNISMGLMLETTAEL------KAHSESPGKKPSTRIEM 153 Methanococcoide...
AAG20121     119 WGYDSIHEYLRAACEIAL-EAGLLPHANPGDQTRAQMATVADVNASMGVMLETTADV------QAHGGPRAKSPEQRLHT 191 Halobacterium s...
WP_011322916 110 WGHDSIHDYLREACDIAL-DCGLLPHSNPGDQTREQMGRVADLNASVGVMLETTAEV------RAHGGPRAKEPGQRLAT 182 Natronomonas ph...
WP_003896522 198 LDDAGRLSIPFTTGLLVGIGETLAERAETMHAIRRSHKEFGHVQEVIVQNFRAKDRTAMASTPDADIDDFLATVAVTRLV 277 Mycobacterium s...
Q57888       185 IENAGKLKIPFTTGLLIGIGETNEEIVDSLFKIKEIHEKYGHIQEVIIQNFRAKKGIPMENFKEPSPIKMLKVIILAKLI 264 Methanocaldococ...
WP_011170820 185 IENAGKLKIPFTTGILIGIGETFEERVNSIFEIKRIHEKYGHIQEVIVQNFRSKPQIPMENYKEPSPVEMFKMIILSKLI 264 Methanococcus m...
WP_010876822 183 IEDAGRLRIPFTTGLLIGIGETIEERAESLLELRRIQDRYGHIQEIIIQNFRSKPGIPMENQREPSLLEMVKMVAAAKIM 262 Methanothermoba...
WP_011405906 193 IENAGKENIPFTTGLLIGIGESKNDRIDSLLKIREIQDQYGHIQEIILQNFKPKSGIPMENHPEPPLVDLIKLTLVATLM 272 Methanosphaera ...
WP_011448274 152 IEDAGRLKIPFTTGILLGIGETRSDRRESLEVIAGLHRKYGHIQEIIIQNFCPKPGTDMSAFPGATLRDMQETVRMAKEI 231 Methanospirillu...
WP_011308327 150 IREAGKLQIPYTTGLLIGIGEIREDRIESLEAIAGLHREYGHIQEVIIQNFAPKPGTPMENFPAPSIEEIIDTICLARQI 229 Methanosarcina ...
WP_011499365 154 IRTAGKLKIPFTTGILVGIGETKDDRKRSLNTIADIHKEFGHIQEVIIQNFMPKPDTPMADHAPPSKEEMIDTVAIAREI 233 Methanococcoide...
AAG20121     192 IDVAGDLGVPFTTGILVGIGEDWRDRAESLLAIRALHERHDHVQEVIVQPVRPNARW---QGEPPGAETMRRVVAMARAV 268 Halobacterium s...
WP_011322916 183 IATAGELGVPFTTGILVGIGETARDRAESILAIRELHERYGHIQEIIVQPVSNNDRW---QQGSPELETLRRATAMARAG 259 Natronomonas ph...
WP_003896522 278 LgPKMRIQAPPNLVSRDeCLALIGAGVDDWGGVSPLTPDHVNPERPWPALDELADVTAEAGYDLVQRLTAQPQYV----- 352 Mycobacterium s...
Q57888       265 Ld-DISIQIPPNLNRET-GQLFLLAGVDDWGGVSPLTRDYVNPEAEWPEIKELREWTEELGLKLKMRLPVYDKYI----- 337 Methanocaldococ...
WP_011170820 265 L-EDISIQVPPNLNRET-GQLFLMAGIDDWGGVSPLTKDFVNPEAPWPDIEELNIFSKELGFTLKERLPVYEKYI----- 337 Methanococcus m...
WP_010876822 263 F-PDVSIQVPPNLNRET-GEIFLLAGADDWGGVSPISRDYVNPEAPWPEIDELKRITESAGFALEERLPVYRKFI----- 335 Methanothermoba...
WP_011405906 273 F-PDISIQIPPNLNQKL-ISLFAFMGADDVGGISPLTMDYVNPESKWPKIKELEYELNSINYNLVERLPVYDKYI----- 345 Methanosphaera ...
WP_011448274 232 LpSDIAIQIPPNLA--D-AAQILPCGVTDLGGISPVTIDYVNPEHPWPAFDELAALTK--GYTLKERLCIYPEYI----- 301 Methanospirillu...
WP_011308327 230 LpSDIAVQVAPNLI--D-PKALIAKGVTDLGGISPLTIDWINPEAEWPDIKELQRKLS--PILLKERLPIYPQYV----- 299 Methanosarcina ...
WP_011499365 234 LpSDVAVQVAPNLI--D-PYSLIKAGASDLGGISPTTIDWINPEAEWPDVIELQKMIKE--IELRERLPIYPQHI----- 303 Methanococcoide...
AAG20121     269 LpAEVGVQVPPNL--TD-VRGLVDCGVDDLGGVSPVTKDHINPDYAWPALDELSAIADHAGVPLRERLPVYERFLpadgg 345 Halobacterium s...
WP_011322916 260 LpAEISVQSPPNLA--P-VRELLDCGVDDLGGVSPVTDDHVNPDYAWPALRELENIAEEAGVPLEERLPVQDRYA----- 331 Natronomonas ph...
WP_003896522 353 --QAGaaWIDPRVRAHVD 368 Mycobacterium smegmatis
Q57888       338 --SEE--WLSEKVYNKII 351 Methanocaldococcus jannaschii DSM 2661
WP_011170820 338 --TEE--WVDKKILEKIK 351 Methanococcus maripaludis
WP_010876822 336 --SRE--FLSPRVMERIE 349 Methanothermobacter thermautotrophicus
WP_011405906 346 --DET--YLKKEVYEKAL 359 Methanosphaera stadtmanae
WP_011448274 302 --RRG--WYHPRLRDCII 315 Methanospirillum hungatei
WP_011308327 300 --RKK--WYSDRIGGLIE 313 Methanosarcina barkeri
WP_011499365 304 --KKG--WYSNNLSYLIE 317 Methanococcoides burtonii
AAG20121     346 taDDG--WVSQRIWRAIE 361 Halobacterium sp. NRC-1
WP_011322916 332 --ASE--WLSPRIQSAIE 345 Natronomonas pharaonis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap