Conserved Protein Domain Family
TIGR03549

?
TIGR03549: TIGR03549 
YcaO domain protein
This family consists of remarkably well-conserved proteins from gamma and beta Proteobacteria, heavily skewed towards organisms of marine environments. Its gene neighborhood is not conserved. This family has an OsmC-like N-terminal domain. It shares a YcaO domain, frequently associated with ATP-dependent cyclodehydration for peptide modification. The function is unknown. Fifteen of the first sixteen members of this family are from selenouridine-positive genomes, but this correlation may not be meaningful.
Statistics
?
PSSM-Id: 132588
View PSSM: TIGR03549
Aligned: 7 rows
Threshold Bit Score: 1418.05
Threshold Setting Gi: 499824611
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011519247   2 EIKVDFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKVYCVARNIPTDNIRLSQNNIVDPEN 81  Cupriavidus met...
WP_011587361  22 EINVNFLDNLRLEAKFDDFTVITDQPIRYKGDGSAPSPFDYFLASSAMCAAYFVKVYCKARDIPTDNIRLSQNNIVDPED 101 Alcanivorax bor...
WP_011235408   2 EINVNFLDNMRLEAKFDDFTVISDQPIRYKGDGSAPGPFDYFLASSVMCAAHFIRLYCDARDIPTENIRVSQNNVVDPED 81  Idiomarina loih...
WP_011042581   2 EIKVNFLDNLRLEAKFDDFSVIADQPIRYKGDGSAPGPFDYFLASSAMCAAYFVKVYCNSRDIPTENIRLSQNNIVDPED 81  Colwellia psych...
WP_011495278   2 EIKVNFLDNLRLEAKFDDFTVTADQPIRYKGDGSAPSPFDYFLASSALCAAYFIKVYCKARDISTENIKLSQNNIVDPED 81  Shewanella deni...
WP_003256021   2 EIKVNFLDNLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCQTRDIPTENIRLSQNNIVDPEN 81  Pseudomonas putida
WP_011505345   2 EIKVNFLENLRLAAKFDDFTVETDQPIRYKGDGSAPSPFDYFLASSALCAAYFVRLYCNARDIPTENIRLSQNNIVDPEN 81  Chromohalobacte...
WP_011519247  82 RYQQIFKIQVELPADISAKDRQGILRSIDRCTVKKVVQTGPEFVIEEVENLDADAQSLLTLKP----ASGASTYISGKDL 157 Cupriavidus met...
WP_011587361 102 RYNQIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPDFQIEQVDSLTEDAQALLMVEP----DEAHRTFIEGKDL 177 Alcanivorax bor...
WP_011235408  82 RYKQLFKIQVELPADISEKDRKAIIRAAERCAVKRVIENDLEFDVEAVESITQDAQALLTIRP----DSDSRTYIEGKDL 157 Idiomarina loih...
WP_011042581  82 RHNQIFQIQVELPESISEKDKKGILRSIDRCTVKKVVQQGPEFKVEAVTSLEDDAQAMLMQQP----DDGVSTFILGKDL 157 Colwellia psych...
WP_011495278  82 RYNQIFQIQVELPDDISDKDREGILRSIDRCTVKKVIQTGPEFNVETVENLSADANAMLMGSS----DQDASTFILGKDL 157 Shewanella deni...
WP_003256021  82 RYNQIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPEFVIEVVDNLDADAQGLLMPVS----DT--STYIPGKDL 155 Pseudomonas putida
WP_011505345  82 RYNQIFKIQVELPEDLSEKDRTGILRAAERCSVKRVIQNAPEFQIETVENIDEDAQALLMGTNakdgDAGGETWIEGKDL 161 Chromohalobacte...
WP_011519247 158 PLEQTIANMSGILAGLGMKIEIASWRNIVPNVWSLHIRDAHSSMCFTNGKGATKESALASALGEFIERLNCNHFYAGTFW 237 Cupriavidus met...
WP_011587361 178 PLEQTIANMTAILAKLGMKIEIASWRNIVPHVWSLHVRDAASPMCFTNGKGATKEAALCSALGEFIERLNCNFFYNDQFF 257 Alcanivorax bor...
WP_011235408 158 PLEQTIANMTAILADLGMKIEISSWRNIVPHVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLSCNFFYNDQYF 237 Idiomarina loih...
WP_011042581 158 PLEETIANMSKLLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALASALGEFIERLNCNFFYNDQFF 237 Colwellia psych...
WP_011495278 158 PLEQTIANMTAMLAELGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGASKESALCSALGEFIERLNNNFFYNDQFF 237 Shewanella deni...
WP_003256021 156 PLEQTIANMSGILAGLGMKIEIASWRNIVPNVWSLHVRDAQSPMCFTNGKGATKEAALASALGEFIERLNCNFFYNDQFW 235 Pseudomonas putida
WP_011505345 162 PLERTIANMTRILEDLGMKIEIASWRNIVPNVWSLHLRDAASPMCFTNGKGATKEAALCSALGEFIERLSCNFFYNDQFF 241 Chromohalobacte...
WP_011519247 238 GEDLANAAFVHYPNERWFKPGRKDALPVEILDEYCLPIYNPDGELRGSHLYETNSGNVQRGICSLPFVRQSDGEVVYFPS 317 Cupriavidus met...
WP_011587361 258 GEEIANSNFVHYPNEKWFKPGPNDALPEGILDDYCLGIYNPEGELGGSNLIDTNSGRADRGICSLPFVRQSDGETVYFPS 337 Alcanivorax bor...
WP_011235408 238 GEEIANAEFVHYPNEKWFKPGTNDELPTEILDEYCRELYDPEGELRGSHLIDTNSGRADRGIVSLPFTRHSDGETVYFPS 317 Idiomarina loih...
WP_011042581 238 GTDIATSDFVHYPNEKWFKAGADDALPSDILDDYCLAIYNPDDELRASNLIDTNSGMTERGICSIPYVRQSDSETVYFPS 317 Colwellia psych...
WP_011495278 238 GTEIANSEFVHYPNEKWFPLEDDDALPAGMLDDYCLEIYNQDDELQGSHLIDTNSGNRERGICAIPYKRKSDGQTVYFPS 317 Shewanella deni...
WP_003256021 236 GEDLANAPFVHYPNEQWFKPGPRDALPAEILDEHCLAIYNPDGELRGSHLYDTNSGNTARGICSLPFVRQSDQQVVYFPS 315 Pseudomonas putida
WP_011505345 242 GEAIADSAFVHYPSERWFPLEDDDALPAGLLDAHCRAIFDPDGELRGSHLIDTNSGRKDRGIVALPFKRRSDGETVYFPS 321 Chromohalobacte...
WP_011519247 318 NLVENLYASNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEMALPDVPQEVLAKYPGIMAGIQVLEEQGFPILVKDASL 397 Cupriavidus met...
WP_011587361 338 NLIENLFLSNGMSAGNTLAEAKVQCLSEIFERAVKKHIIEEEIALPDVPQEVLAKYPGIVEGITALEEQGFPVLVKDASL 417 Alcanivorax bor...
WP_011235408 318 NLIENLYLSNGMSAGNTLPEAQVQCLSEIFERAVKKHIIEEEIALPDVPQEVLNKYPNILEGIKALEEQGYPVLVKDASL 397 Idiomarina loih...
WP_011042581 318 NLIENLFLSNGMSAGNNLPEAQVQCLSEIFERAVKKQIIAEEIVLPDVPKDVIAKYPAILAGIEGLEAQGFPVVVKDASL 397 Colwellia psych...
WP_011495278 318 NLIENLFLSNGMSAGNNLQEAEVQCLSEIFERAVKRQIIEQEIVLPDVPMSVLEKYPSILAGIKGLEEQGFPIVVKDASL 397 Shewanella deni...
WP_003256021 316 NLIENLFLSNGMSAGNTLAEAQVQCLSEIFERAVKREILEGELCLPDVPQEVLAKYPAILAGIQGLEEQGFPVLVKDASL 395 Pseudomonas putida
WP_011505345 322 NLIENLYLSNGMSAGNTLAEAEVQCLSEIFERAVKKEIIEQEIVLPDVPEEVLAKYPGIQEGIAALEAQGFPVLVKDASL 401 Chromohalobacte...
WP_011519247 398 GGIYPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPRPSFVSNAVTEPNNFVEHFIDSSGVVS 477 Cupriavidus met...
WP_011587361 418 GGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPPPTFNSQEVCEPNNFVEHFIDSSGVVS 497 Alcanivorax bor...
WP_011235408 398 GGQFPVACVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPAPTFNSMAVTEPNNFVEHFIDSSGVVS 477 Idiomarina loih...
WP_011042581 398 GGKFPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVDHFIDSTGVVS 477 Colwellia psych...
WP_011495278 398 GGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVEHFIDSTGVIS 477 Shewanella deni...
WP_003256021 396 GGEFPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPQPTFESHALTEPNNFVEHFIDSSGVVS 475 Pseudomonas putida
WP_011505345 402 GGRYPVMCVTLMNPRTGGVFASFGAHPSFQVALERSLTELLQGRSFEGLNDLPQPTFSSLAVSEPNNFVEHFIDSSGVIS 481 Chromohalobacte...
WP_011519247 478 WRFFSAKSDFDFVEWDFSGqgknSNTEEAATLLSILEGMGKEVYMAVYDQLGSVACRILVPGYSEVYPVEDLIWDNTNKA 557 Cupriavidus met...
WP_011587361 498 WRFFSAQADESFCEWDFSG----TTEEESARLFGILESLEKEAYVAVYEELGAPVCRILVPDFSEVYPVEDLVWDNTNMA 573 Alcanivorax bor...
WP_011235408 478 WRFFSAKSDIEFVEWDFSG----SNQEEADTLFGILQDMGKEAYIAVHEDLGAPVCRILVPGYSEVYPVEDLIWDNTNIA 553 Idiomarina loih...
WP_011042581 478 WRFFSAKHDYEFVEWDFSG----TNEEENAGLMDILKDLDKEVYIAEFNQLGATACRILVPDYSEVYPVEDLIWDNTNKS 553 Colwellia psych...
WP_011495278 478 WRFFSSKHDYDFCEWDFSG----TSEEEAKGLFAILEAMGKEVYIAEFTELGASACRMLVPDYSEVYPVDDLIWDNTNKA 553 Shewanella deni...
WP_003256021 476 WRFFSAKADFEFVEWDFSGhgedSNQQEAATLFGILEDLGKEVYMAVYDNLGATACRILVPGYSEIYPVEDLIWDNTNRA 555 Pseudomonas putida
WP_011505345 482 WRFFSDRTDLDFHEWDFAG----TTAEEAERLYGLLADQGLEAYVMEHEDLGAPVCRILVPGYSEVYPVEDLVWDNTNMA 557 Chromohalobacte...
WP_011519247 558 LSFRADILNLHRLDDESLEALLERLDNSELDEYADIATLIGIEFDENTDWGQLTVLELKLLIHLALQQFEAAHELVGAFL 637 Cupriavidus met...
WP_011587361 574 LDYREDILNLHRLSDEQLSQLVERLEESQIDNYTDIITLIGIEFDENTVWGQLTILELKLLIYLALQRHEDALELVDMFI 653 Alcanivorax bor...
WP_011235408 554 LQYREDILNLHRLTDDQLEDLVERLEDSQLDNYMDIITLIGIEFDENTVWGQLTILELKLLIYLALQRHDDAFEYVEMFL 633 Idiomarina loih...
WP_011042581 554 LDYREDILNLHRLDDEALTGLFDRLEESQQDNYIDIRTLIGIEFDENTVWGQLTILELKILICLALGALEDATELVGEFL 633 Colwellia psych...
WP_011495278 554 LLYREDILNLHSLSTKALVKLVNRLEESQLDNHTDIRTLIGIVFDENTVWGKLTIIELKIMIYLALGSHEDAIELVGEFL 633 Shewanella deni...
WP_003256021 556 LSFRADILNLHSLDSRSLKLLLKRLDNCDVDDYTTITTLIGVEFDENTVWGQLTILELKLLICLAVQRFEDAKELVEAFL 635 Pseudomonas putida
WP_011505345 558 LDFRADILHLHTLEDERLADLLERLEESQLDDHIKVGTLIGIEFDDNTVWSELTILELKLLIELALGEYEAALEHVQMFL 637 Chromohalobacte...
WP_011519247 638 QYNDNTLERGLFYQALDVVLEVLLDDDLDLEDYKVNFRRMYGNARMDAVLGSVDGSVRFFGLTPTSMKLEGLDRHHRLID 717 Cupriavidus met...
WP_011587361 654 QFNDNTVERGLFYRAVNAVLEITLDEELSLDDYRTNLGRMYGEDTLETVIGAVEGSLRFPGLTPTNMQLEGLEKHQRLIE 733 Alcanivorax bor...
WP_011235408 634 QFNDNTVERTLFYRAIEAVLEITLDEELELDDYRYNLGRMYGEETIEAVIGSVNGTTRFYGLTPTNMQLEGLDRHLRLIE 713 Idiomarina loih...
WP_011042581 634 QYNDNTVERGLFYQAVHAVLEVTLDEEMELEDYLGNFNRMFGAENMEQVVGSVYGEVRFYGLTPTSMKLEGLDKHLRLIE 713 Colwellia psych...
WP_011495278 634 QFNDNTVQRGLFYQAVSAVLEVTLDEDLELEHFIESFNRMYGKDVMDNVVGSVNGTVRFYGLTKTSMQLEGIEPHLRLIE 713 Shewanella deni...
WP_003256021 636 QFNDNTVDRGLFYQALNVVLEVQLDDELEMDDYEANFRRMFGNARMDAVLGSVDGSVRFHGLTPTSMKLEGLDRHLRLID 715 Pseudomonas putida
WP_011505345 638 QFNDNTVQRGLFHQAMQAVLEIALDDDLDFNDYHRNLTRMFGEETMRQVIGAVNDEIRFPGLTPTSMGLEGIDRHQRLIE 717 Chromohalobacte...
WP_011519247 718 SYKKLH 723 Cupriavidus metallidurans
WP_011587361 734 SYKKLH 739 Alcanivorax borkumensis
WP_011235408 714 SYKKLH 719 Idiomarina loihiensis
WP_011042581 714 SYKKLH 719 Colwellia psychrerythraea
WP_011495278 714 SYKKLH 719 Shewanella denitrificans
WP_003256021 716 SYKKLH 721 Pseudomonas putida
WP_011505345 718 SYRKLH 723 Chromohalobacter salexigens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap