3ASA


Conserved Protein Domain Family
DAPAT_plant

?
TIGR03542: DAPAT_plant 
Click on image for an interactive view with Cn3D
LL-diaminopimelate aminotransferase
This clade of the pfam00155 superfamily of aminotransferases includes several which are adjacent to elements of the lysine biosynthesis via diaminopimelate pathway (GenProp0125). This clade includes characterized species in plants and Chlamydia. Every member of this clade is from a genome which possesses most of the lysine biosynthesis pathway but lacks any of the known succinylases, desuccinylases, acetylases or deacetylases typical of the acylated versions of this pathway nor do they have the direct, NADPH-dependent enzyme (ddh).
Statistics
?
PSSM-Id: 163316
View PSSM: TIGR03542
Aligned: 9 rows
Threshold Bit Score: 697.243
Threshold Setting Gi: 345110725
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ASA_A         1 MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPAL 80  Chlamydia trach...
WP_010875692   2 VTVNENYLLLKSSYIFSEINRRVEEFQRKNPDADIIRMGIGDVTRPLPEAVVEAFHRAVDEMAEEETFRGYGPEQGYPFL 81  Methanothermoba...
WP_010940837   2 AKINDHYLKLKAGYLFPEIGRRVREFAAANPSAKVIRLGIGDVTRPLAPAVIKAFHEAVDDLATTENFAGYGPEQGYDWL 81  Geobacter sulfu...
WP_014546478   4 SIVNTNYDLLPGSYLFSTIAQKIKEYQGAHADADIIRLGIGDVTTPLIPEVIKAMHNAVDEMAVKGTFRGYGPEQGYDFV 83  Fibrobacter suc...
WP_011175235  11 VKRNVHLTKLQSGYLFPEINRRKNEFLKKHPSAQLINLGIGDTTQPIPLYISEAMQNFAKQLASEKTYRGYGTEQGSILL 90  Candidatus Prot...
WP_011458307   1 MRRNSNFSSLETNYLFSSIRQKIRSFREKHPEISIIDLSIGDTTQPLHASVIDTFSTSVRKLGNPKTYRGYGPELGLPAL 80  Chlamydophila f...
WP_010883133   1 MRRNPHFSLLKPQYLFSEISKKLAQFRKENPEISVIDLSIGDTTQPLCRSITQAIKEFCVSQEKQETYRGYGPETGLEKL 80  Chlamydia pneum...
WP_014541418  13 MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPAL 92  Chlamydia trach...
WP_005793370   2 ALVNEHFLKLPGSYLFSDIAKKVNTFKITHPKRDIIRLGIGDVTRPLPKACIEAMHKAVEEMTSAETFRGYGPEQGYDFL 81  Bacteroides
3ASA_A        81 RQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGA-----------KEIIAL 146 Chlamydia trach...
WP_010875692  82 REAIAENDYASRgvdITADEIFISDGAKCDTGNIQEIFGLDNVVAVTDPVYPVYVESNVMAGRagpad-ddgrySGLVYL 160 Methanothermoba...
WP_010940837  82 INAIIEKSYKPLgvdLKTEEMFISDGSKCDCANILDIFALDNVVAIGDPVYPVYNDTNVMIGRtgead-dkgyyKGIVYM 160 Geobacter sulfu...
WP_014546478  84 REAIVRGEYTARgieMDPNDIFVSDGSKCDVANIQELFTENVNIAIPDPVYPVYLDSNVMAGRagvlq-ddgrfSKVTYL 162 Fibrobacter suc...
WP_011175235  91 REAIAEQYYQGK---IDPQEVFVSDGSKCDVGRLQILFGSDATIAVQNPTYPAYVDTGVINGQasffqtstkqyQRITYM 167 Candidatus Prot...
WP_011458307  81 KEKLSEVCYRGK---VSPEEIFISDGAKTDIFRLFSLFGPGKTIAVQDPSYPAYIDAAILAGA-----------RKIVKL 146 Chlamydophila f...
WP_010883133  81 RTKIASEVYENR---ISPEEIFISDGAKPDIFRLFSFFGSEKTLGLQDPVYPAYRDIAHITGI-----------RDIIPL 146 Chlamydia pneum...
WP_014541418  93 RQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGA-----------KEIIAL 158 Chlamydia trach...
WP_005793370  82 IEAIIKNDYAPRgihLSPTEVFVNDGAKSDTGNIGDILRHDNSVGVTDPIYPVYIDSNVMCGRagvldtesgkwSNVTYM 161 Bacteroides
3ASA_A       147 PCLQENAFFPEFPEDThIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARF 226 Chlamydia trach...
WP_010875692 161 PCTEENSFIPSLPEER-VDLIYLCYPNNPTGTTLTEKQLAEWVDYARDSGSLILFDAAYEAYIQEDGIPHSIYEVEGARE 239 Methanothermoba...
WP_010940837 161 PCTEENGFIPSLPTEk-VDIIYLCFPNNPTGTVATKAELKKWVDYAIANDAVIFFDAAYEAFITDPAIPHSIYEIEGAKK 239 Geobacter sulfu...
WP_014546478 163 ASTAENNFQPDLPKNP-VQLIYLCSPNNPTGTVLSRETLQKFVNYANENGALILFDGAYNCYIQDESLPHSIFEIPGART 241 Fibrobacter suc...
WP_011175235 168 SCLPENNFFPDLANLPkTDLIYFCSPNNPTGSAATNEQLRELVQFAKKRQSIIIFDAAYASFVRSSHIPRSIYEIEGAKE 247 Candidatus Prot...
WP_011458307 147 PCTKETDFFPVIPQEEnIDIFCLCSPNNPTGTVLNREQLKELIDYANSHGSIILFDAAYSAFISDPSLPTSIFEIPEARF 226 Chlamydophila f...
WP_010883133 147 ACRKETGFIPELPNQQsLDILCLCYPNNPTGTVLTFQQLQALVNYANQHGTVLIFDAAYSAFVSDPSLPKSIFEIPEAKY 226 Chlamydia pneum...
WP_014541418 159 PCLQENAFFPEFPEDThIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARF 238 Chlamydia trach...
WP_005793370 162 PCTAENHFIPAIPEKR-IDIVYLCYPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEAYIREPDIPHSIYEIKGAKK 240 Bacteroides
3ASA_A       227 CAIEINSFSKPLGFAGIRLGWTVIPQELTYADG----H----FVIQDWERFLSTTFNGASIPAQ---EAGVAGLSILPQL 295 Chlamydia trach...
WP_010875692 240 VAIEFRSFSKNAGFTGTRCAFTVVPEELEVPDSsgrmH----SVRELWNRRQTTKFNGVSYPVQraaEAVYTPEGQREIR 315 Methanothermoba...
WP_010940837 240 CAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTTPtgekY----SFNKLWLRRTTTKFNGASYPVQkaaAAVYSDEGWQQNK 315 Geobacter sulfu...
WP_014546478 242 CAIEFRSFSKTAGFTGVRCAYTVIPHELS-------------KLHAMWNRRQCTKFNGVSYVTQraaEAIYSPVGWQQTK 308 Fibrobacter suc...
WP_011175235 248 VAIEVGSFSKMIGFTGVRLGWSVVPKQLRFEDG----H----SVQQDWERIVCTFFNGASNIAQaggLAALQKEGLQAID 319 Candidatus Prot...
WP_011458307 227 CAIEINSFSKSLGFAGVRLGWNIVPKDLKYSDG----S----LIIRDWERFLCTTFNGASLPVQ---EAAIAGASLFPNL 295 Chlamydophila f...
WP_010883133 227 CAIEINSFSKSLGFTGMRLAWNVIPKELTYDNN----E----PMINDWKRLFATTFNGASLLMQ---EAGYYGLDLFPTP 295 Chlamydia pneum...
WP_014541418 239 CAIEINSFSKPLGFAGIRLGWTVIPQELTYADG----H----FVIQDWERFLSTTFNGASIPAQ---EAGVAGLSILPQL 307 Chlamydia trach...
WP_005793370 241 CAIEFRSFSKTAGFTGVRCGYTVVPKELTAATL----EgeriPLNRLWNRRQCTKFNGTSYITQraaEAIYTPEGKEQIQ 316 Bacteroides
3ASA_A       296 EAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKpTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGK 375 Chlamydia trach...
WP_010875692 316 ESIDYYMENARIIRESLERAGLRYYGGVNAPYIWIR-TPEGMDSWQFFDTLLNDAEVVGTPGSGFGPSGEGYFRLTAFNS 394 Methanothermoba...
WP_010940837 316 EIIDYYMENARIIREGLAAAGLTVYGGVNAPYIWLK-TPGGMSSWDFFDKLLNECNVVGTPGSGFGPSGEGFFRLSAFGH 394 Geobacter sulfu...
WP_014546478 309 EVIAGYMRTAGVIRKELTAAGYTVFGGEHAPYIWWK-IPDGEKSFDFFDRLLATCEVVGTPGSGFGPCGEGYFRLTAFGD 387 Fibrobacter suc...
WP_011175235 320 ELSSYYMKNSNILKKAFEECGYKVYGGENVPYLWVH-FPQ-LTSWEAFEILLKQSQLVSVPGSGFGSAGEGFLRFSAFGK 397 Candidatus Prot...
WP_011458307 296 EAISKYRYNSSLLREALQKAEFVVHGGEHAPYLWVE-VPSMIPDEDFFDFFLYQYHIAITPGKGFGSCGTGYVRFSSLGK 374 Chlamydophila f...
WP_010883133 296 PAISLYLTNAQKLKKSLETAGFSVHGGDHAPYLWVE-LPEGISDEEAFDFFLHQYHIAVTPGHGFGSCGQGFVRFSALTQ 374 Chlamydia pneum...
WP_014541418 308 EAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKpTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGK 387 Chlamydia trach...
WP_005793370 317 ETINYYMTNARIMKEGLESTGLKVYGGVNAPYLWVK-TPKGTSSWRFFDQMLYEANVVGTPGVGFGPSGEGYIRLTAFGE 395 Bacteroides
3ASA_A       376 REDILAACERLQMAP 390 Chlamydia trachomatis
WP_010875692 395 FRNTVKAMERISELS 409 Methanothermobacter thermautotrophicus
WP_010940837 395 RENVIEAVERIKKNL 409 Geobacter sulfurreducens
WP_014546478 388 YERTCEALKRIREKL 402 Fibrobacter succinogenes
WP_011175235 398 QSDITVALPRIKHAL 412 Candidatus Protochlamydia amoebophila
WP_011458307 375 SENIVAACQRLSQTS 389 Chlamydophila felis
WP_010883133 375 PQNIALACDRLCTAS 389 Chlamydia pneumoniae
WP_014541418 388 REDILAACERLQMAP 402 Chlamydia trachomatis
WP_005793370 396 RDDCIEAMRRIKNRL 410 Bacteroides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap