Conserved Protein Domain Family
reg_near_HchA

?
TIGR03541: reg_near_HchA 
LuxR family transcriptional regulatory, chaperone HchA-associated
Members of this protein family belong to the LuxR transcriptional regulator family, and contain both autoinducer binding (pfam03472) and transcriptional regulator (pfam00196) domains. Members, however, occur only in a few members of the Gammaproteobacteria that have the chaperone/aminopeptidase HchA, and are always encoded by the adjacent gene.
Statistics
?
PSSM-Id: 132580
View PSSM: TIGR03541
Aligned: 5 rows
Threshold Bit Score: 355.246
Threshold Setting Gi: 489203389
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003112485   5 ASLLFDSVARLRKAATTEAVCREMVEFAARLGFDRVIVcsLFPRPDEDELIDELFFVHGDWAEGRSAQERDAYLLHCPVT 84  Pseudomonas
EEO01730      14 AVDLITLISQLEESHSFSTVQDIVRQRAHFYGYDKIVF--FSAHSTLDGIIERIYWIEGDWFDDGENIDAATYIKYCPIT 91  Vibrio albensis...
WP_011534036   3 FDKVVQAVQQIEQATTLALIQSAVRSVARPLGYDRFVL--FSANAARDEVVERIHWVEGDWFGDGLRVDAQTYIRHCPVN 80  Pseudomonas ent...
WP_011333674   6 AEALLRAALDIEAAPTLVAIQKAVRGFAGAYGYDRFVL--FSATSASEDVVERIYWVEGDWFGDGIAVDAQTYVQRCPVT 83  Pseudomonas flu...
WP_004926231   9 AELLFQTLRQIRQASKIEDIFDVVVEFAQNIDFDRLIIcsIAPH-GKEELIDEVFFVYGNWTDRTNIEERNKYLRNCPIT 87  Acinetobacter
WP_003112485  85 RHILELDEPFFWSKSPSEDPERmtYRIVRGVRDLGqV-NGMQVPVFGRNGLEGAVSFAGERLDLNAGCKLAAQAFCPILF 163 Pseudomonas
EEO01730      92 RHIIETDRPFFWTKKPDVNREQ--YRVVAKPKGSG-I-HGLQIPIFGHLGLEGAVSLGGKAIDSSPRARCELSLLSTYAF 167 Vibrio albensis...
WP_011534036  81 RHLLTAREPFFWSKREGEGGER--YHVVRAPVGTG-V-HGLQVPVFGPAGLEGAMSLGGLHIDASPATRMCLALLANAAF 156 Pseudomonas ent...
WP_011333674  84 RHLLDARESFFWSKVQEQSGEL--YRLVRVPSGPG-V-HGLQIPVFGPQGLEGAMSLGGEQIDASARVRLALGMLASVAF 159 Pseudomonas flu...
WP_004926231  88 RHIFDYDEPFFWTKTFNKNNSKetYRVIKNISERG-EeSGVQVPIFGRTGLEGAISFAGKLSDLGADFRFILQSVCVTAF 166 Acinetobacter
WP_003112485 164 FALKRLRGPVSAGDAQALSEREREVLQWIALGKQQAEVAAILMISERTVENHLRAARRRLGAASTAQAVARALRLGDI 241 Pseudomonas
EEO01730     168 FAARRLLESSDPNRSALLSKREKEVLSLTALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRGDI 245 Vibrio albensis V...
WP_011534036 157 HAARRLLEAPVGQEVGVLSERERQVLAWTAAGQRQADIAATLGLSVRTVENHLRAARRRLGVATTAQAIRIALGSGVL 234 Pseudomonas entom...
WP_011333674 160 FSARRLLEAPLDETAGKLSTREREVLAWVAAGRRQADIAATLGLSGRTVENHLRSARRHLGVATTAQAIKIAIRKGEI 237 Pseudomonas fluor...
WP_004926231 167 REIQSKRSLNLLRENSVLTQREKEILKWTAVGRKQSEIAEILKISERTVENHLRSIRKKLEVKSTGQAIASALLKGEI 244 Acinetobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap