Conserved Protein Domain Family
DapC_actino

?
TIGR03539: DapC_actino 
succinyldiaminopimelate transaminase
This family of actinobacterial succinyldiaminopimelate transaminase enzymes (DapC) are members of the pfam00155 superfamily. Many of these genes appear adjacent to other genes encoding enzymes of the lysine biosynthesis via diaminopimelate pathway (GenProp0125).
Statistics
?
PSSM-Id: 132578
View PSSM: TIGR03539
Aligned: 9 rows
Threshold Bit Score: 533.929
Threshold Setting Gi: 499499761
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011775448  12 LPDYPWEAMAPYVATAAKHPGGAVNLSIGTPVDPTPGLIREALANAADAHGYPTVHGTEALRQAVVDWFAGRRGVPG-LD 90  Arthrobacter au...
WP_010984558   8 LPTFPWDKLEPYKARAAAHPDGIVDLSVGTPVDPVPELIQKALVAAADSPGYPTVWGTPELRDALTGWVERRLGARG-VT 86  Streptomyces av...
WP_011273858  12 LPDFPWDSLAEAKAKATSHPDGIVDLSVGTPVDPVSPAIQLALTESAAEPGYPQTKGTPELREAIVGAMERRFQVRG-LD 90  Corynebacterium...
WP_011211286  15 LPDFPWDTIAAVKAKAAAHPGGIVDLSVGTPVDPVAPVIRTALDSVAEVPGYPTTHGTPELRAAAVDALKRRYGVTG-VD 93  Nocardia farcinica
WP_011290939  11 LPTFPWDRLAPYKETAAQHPDGIVDLSVGTPVDPVPPRLRAALAEAADTPGYPQTYGTRALRESISGWLARRHQVQ--VD 88  Thermobifida fusca
WP_002518122  10 LPTFPWDTIAEARRKAQSHPDGIVDLSMGTPVDPAPGVAIAALTAAGDAHGYPQVWGTPALRAGILDHMKQVWGAPAsLE 89  Propionibacterium
WP_010934708  11 LPDFPWDSLADAKKTASSHPDGLINLSVGSPVDEVAPGIRLALAEAAAAPGYPQTIGTQELRAAIVDSLQRRYHATS-L- 88  Corynebacterium...
EYT93727       3 LPDFPWDQLVSFKEKARLHPYGLVDLSVGTPVDATPAVVQQALAGSADAPGYPLTAGTPELREAAAGWLARRLGVL--VD 80  Frankia sp. Thr
WP_011186401   6 LPDYPWDLMAPYAARAREHADGLVDLSIGSPVDATPALIRDALAAATDAHAYPQTAGTLALREAIVAWFERRRAVPG-LS 84  Leifsonia xyli
WP_011775448  91 -PKDVMPTVGSKELVAWLPFLLGLSAGDVVVRPTVAYPTYDIGASLAGATAVAADDLDELDPAtraKVRLIWINSPGNPT 169 Arthrobacter au...
WP_010984558  87 -HHHVLPIVGSKELVAWLPTQLGLGPGDKVAHPRLAYPTYEVGARLARADHVVYDDPTELDPT---GLKLLWLNSPSNPT 162 Streptomyces av...
WP_011273858  91 aDTQVLPVIGTKEAIAWMPTLLGIGAGHTVVIPELAYPTYEVSARLAGADVLRSDSLLKLGPE---TPALIYLNSPANPH 167 Corynebacterium...
WP_011211286  94 -PAAVLPVIGTKELIAGLPRLLGVGPADLVVIPEIAYPTYEVGALLAGAQILRADGLTRLGPQ---SPALIYLNSPSNPT 169 Nocardia farcinica
WP_011290939  89 -PDATLPTIGSKELVAWLPTLLGLGPGDTVVFPELAYPTYDVGARIAGATPVAADSLTQLGPV---RPGLLWINSPANPT 164 Thermobifida fusca
WP_002518122  90 -ETSVLPVIGTKELVASLPGQLGLGPDSTIVIPACAYPTYRVGAQLAGAKIVAVNEPDEVD-V---APDLIWINSPANPS 164 Propionibacterium
WP_010934708  89 --GGVLPVVGTKEAIALLPTLLGIR--GTVVIPEVAYPTYEVGALMAGATPLRCDAPHELPND---DIDLVFINSPSNPT 161 Corynebacterium...
EYT93727      81 -PGAVLPVLGTKELVAQLPGQLGLEPGDRVWVPTPAYPTYEVGALLARCEPVAG------PAD---GVTLIWLNSPGNPT 150 Frankia sp. Thr
WP_011186401  85 -AENVLPTIGSKELVALLPFFLGLGHGDAVVHPRAAYPTYAIGAAIAGAAAVASDDPAEW-PE---STRLVWLNSPGNPD 159 Leifsonia xyli
WP_011775448 170 GSVRDVESLQRIVAQARELGAVVASDECYAELGWg-EwdaqrggeA-VPSILDPRVTGGSTDGLLCVYSLSKQSNLAGYR 247 Arthrobacter au...
WP_010984558 163 GKVLSKAELTRIVAWAREHGILVFSDECYLELGWe-A--------D-PVSVLHPDVCGGSYEGIVSVHSLSKRSNLAGYR 232 Streptomyces av...
WP_011273858 168 GQVLGVDHLRKFVEFARERGTIIVSDECYLGLGWgeE--------R-PVSILDPEVCGGDFTNLIAVHSLSKTSNLASYR 238 Corynebacterium...
WP_011211286 170 GRVLGVEHLRKVVAFARERGAVVASDECYLGLSWd-A--------R-ALSILDPQVCDGDHTGLLAIHSLSKTSNLASYR 239 Nocardia farcinica
WP_011290939 165 GRVLGLEHLRKVVSWARERGVVVASDECYLELGWe-G--------ErPLSILHPEVCGGSHEGLLAVHSLSKRSNLAGYR 235 Thermobifida fusca
WP_002518122 165 GRVLDLDEMKAWVDLARSTGAVLASDECYGEFVWe-G--------E-SVSVLDERVNSGDVTGLLACLSMSKRSNMAGYR 234 Propionibacterium
WP_010934708 162 GRVASVEELRSIVAWAQANDVIVASDECYLGLAWd-G--------E-AVSILDPRVNDGNLSNLLAIHSLSKSSNLASYR 231 Corynebacterium...
EYT93727     151 GRVLTVDEMRAVVTWARERGVIVASDECYIELGWe-S--------R-PVSVLHPDVCGGSHEGLLAVHSLSKRSNLAGYR 220 Frankia sp. Thr
WP_011186401 160 GHVLSVDQLRAAVVRARELGAYLASDECYAELGWe-Ppwd---aqR-VPSVLDPRVTGEDRRGVLAVYSLSKQSNLAGYR 234 Leifsonia xyli
WP_011775448 248 AAFVAGDSAIMANLVNSRKHAGMIVPYPVQEAMRVALGDVGHVLAQKDLYRGRRERIVPALEKFGLTIHESKAGLYLWST 327 Arthrobacter au...
WP_010984558 233 AAFLAGDPAVLGPLLQIRKHGGMMTSAPTQAAVVAALGDDAHVREQRERYAARRTALRDALLSHGFRIEHSEASLYLWAT 312 Streptomyces av...
WP_011273858 239 AGWLAGDDELIQELLGIRRHAGLMNPGPIQSAMVAALVEDGHEILQKQLYRHRRDLLKAALLQAGFDIEYSDGGLYLWAT 318 Corynebacterium...
WP_011211286 240 AGFVAGDPELVAELLEVRKHSGMMVPFPIQAAMTAALADDTHEAQQRERYRVRREQLRAALTAAGFRIDHSEAGLYLWST 319 Nocardia farcinica
WP_011290939 236 AGFVAGDPALVQQLLQARKHAGMMVPAPVQAAMRAALDDDEHAEEQKQRYAARRTQLRDALEKAGWQITHSEAGLYLWAS 315 Thermobifida fusca
WP_002518122 235 AGFAVGDAELTSELLTVRKHSGLMIPAPVVAAMQAALADRSHVLEQVKRYRLRRNVLKPALEKAGFRIDHSEGSLYLWAT 314 Propionibacterium
WP_010934708 232 AGFLAGDEALIAELTEIRKHSGLMVPGPIQAAMVEALRDDDQEALQKLRYARRRALLMRALIDAGFTVEHSEAGLYLWAT 311 Corynebacterium...
EYT93727     221 AGFVTGDPALVEGLLAVRKHAGFMMPTPVQAAMAAAYADDMHVADQRARYANRRAVLAAALAVAGFTIDHSEAGLYLWAT 300 Frankia sp. Thr
WP_011186401 235 AAFVAGCPALVARLTTVRKHAGLMLPAPLQAAMVAALGDDEHVAAQRARYAARRAQLKPALEAAGFRVDRSEGGLYLWAT 314 Leifsonia xyli
WP_011775448 328 AGE-ATWDTVARFAELGIVVGPGVFYGDAGNGFIRVALTGSDERIDAAVERLT 379 Arthrobacter aurescens
WP_010984558 313 RGE-SCWDTVAHLADLGILVAPGDFYGSAGEQFVRVALTATDERVAAAVRRLA 364 Streptomyces avermitilis
WP_011273858 319 QGR-DGRETVAELADKGILVAPGDFYGPKGKEFVRVGLTATDERIEAAVRRLT 370 Corynebacterium jeikeium
WP_011211286 320 RGE-NARTTLDWLAERGILAAPGDFYGPASGEHVRIALTATDERIAAAVARLT 371 Nocardia farcinica
WP_011290939 316 HPDyDAWGSVRVLAEQGILVAPGEFYGPAGARHVRVAFTATDERVAAAVKRLA 368 Thermobifida fusca
WP_002518122 315 HDE-DCRVTLDRLADLGILCSPGDFYVAGGSDHVRIGLTATDERINAAAQRIQ 366 Propionibacterium
WP_010934708 312 RGE-NCRATVDWFASHGILVAPGDFYGPDAHNFVRVALTTTDDNAEKVAARLQ 363 Corynebacterium diphtheriae
EYT93727     301 RGE-EAWATVDALAEVGILVAPGTFYGEAGRYHVRIALTAADSQVATVPERMT 352 Frankia sp. Thr
WP_011186401 315 EGR-DAWETIGRLAGLGVLGGPGHFYGDHYPQHVRLSLTATDERIADAAARLR 366 Leifsonia xyli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap