3JTX


Conserved Protein Domain Family
DapC_gpp

?
TIGR03538: DapC_gpp 
Click on image for an interactive view with Cn3D
succinyldiaminopimelate transaminase
This family of succinyldiaminopimelate transaminases (DapC) includes the experimentally characterized enzyme from Bordatella pertussis. The majority of genes in this family are proximal to genes encoding components of the lysine biosynthesis via diaminopimelate pathway (GenProp0125).
Statistics
?
PSSM-Id: 274637
Aligned: 11 rows
Threshold Bit Score: 644.837
Threshold Setting Gi: 501635184
Created: 9-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JTX_A         3 NTLLKQLKPYPFARLHEAXQGISAPEGXEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRR 82  Neisseria menin...
WP_011398994   2 NPNLSRLQPYPFEKLAQLKQSAHPPEHLPHIALSIGEPKHAPPEFALEVLRNNMSALSRYPTTKGEPELRQAIVRWLEKR 81  Hahella chejuensis
WP_011332680   2 NNALSQLQPYPFEKLRALLGSVTPNPDKRPIALSIGEPKHRSPSFVAEALANNLEQMSVYPTTLGIPALREAIAAWCERR 81  Pseudomonas flu...
WP_010960767   2 NPKLASLHPYPFEKLADLKRGRLPPADKPHIAMSIGEPQHPTPHFIAEALLQHLHGLASYPTTKGGPELRRCIAQWLERR 81  Methylococcus c...
WP_002808767   3 NPNLDRLQPYPFQRLAQLIREIIPPPSKPPLALSIGEPKHATPNFIVETLVSHLHGLATYPTTRGIAGFREAIAAWLTQR 82  Nitrosococcus o...
WP_004927518   2 NSSLSLLHPYPFEKLNVLFKDVTP-ADLPLIPLSIGEPKHPAPEFVKQAIIDNFNHLSTYPNSKGLPELRESIARWLTQR 80  Acinetobacter
WP_011239427   2 NPNLDRLQSYPFEKLRKLFEGLTPPAGLDTIRLSIGEPRHATPAFITQALVDNLDGLSAYPATQGSDALRGAIAGWLERR 81  Aromatoleum aro...
WP_011505868   2 NPDLDALKPYPFEKLAALKAGVTPSAS-SPIALSIGEPRHAPPAAVLDAMRRFEGEVARYPATAGLPELRDAIARWASRR 80  Chromohalobacte...
WP_002225352   2 NTLLNQLKPYPFARLREAMQGISAPEGLEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRR 81  Neisseria menin...
WP_012607243   7 NPLLETLQAYPFERLRALLAGTIPPV-KEPIDFSIGEPRHPAPAIVSEAIIEHLHGLAEYPKVLGDLRLRRAIADWASRR 85  Acidithiobacill...
WP_011279699   2 NHNLTTLHPYPFAKMATLLADSTPAHSYDEIKLGIGEPKHAPPAFVLDVLRENLDKISHYPTTNGLFELRQTIAHWLEKR 81  Psychrobacter a...
WP_011398994   2 NPNLSRLQPYPFEKLAQLKQSAHPPEHLPHIALSIGEPKHAPPEFALEVLRNNMSALSRYPTTKGEPELRQAIVRWLEKR 81  Hahella chejuensis
WP_011332680   2 NNALSQLQPYPFEKLRALLGSVTPNPDKRPIALSIGEPKHRSPSFVAEALANNLEQMSVYPTTLGIPALREAIAAWCERR 81  Pseudomonas flu...
WP_010960767   2 NPKLASLHPYPFEKLADLKRGRLPPADKPHIAMSIGEPQHPTPHFIAEALLQHLHGLASYPTTKGGPELRRCIAQWLERR 81  Methylococcus c...
WP_002808767   3 NPNLDRLQPYPFQRLAQLIREIIPPPSKPPLALSIGEPKHATPNFIVETLVSHLHGLATYPTTRGIAGFREAIAAWLTQR 82  Nitrosococcus o...
WP_004927518   2 NSSLSLLHPYPFEKLNVLFKDVTP-ADLPLIPLSIGEPKHPAPEFVKQAIIDNFNHLSTYPNSKGLPELRESIARWLTQR 80  Acinetobacter
WP_011239427   2 NPNLDRLQSYPFEKLRKLFEGLTPPAGLDTIRLSIGEPRHATPAFITQALVDNLDGLSAYPATQGSDALRGAIAGWLERR 81  Aromatoleum aro...
WP_011505868   2 NPDLDALKPYPFEKLAALKAGVTPSAS-SPIALSIGEPRHAPPAAVLDAMRRFEGEVARYPATAGLPELRDAIARWASRR 80  Chromohalobacte...
WP_002225352   2 NTLLNQLKPYPFARLREAMQGISAPEGLEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRR 81  Neisseria menin...
WP_012607243   7 NPLLETLQAYPFERLRALLAGTIPPV-KEPIDFSIGEPRHPAPAIVSEAIIEHLHGLAEYPKVLGDLRLRRAIADWASRR 85  Acidithiobacill...
WP_011279699   2 NHNLTTLHPYPFAKMATLLADSTPAHSYDEIKLGIGEPKHAPPAFVLDVLRENLDKISHYPTTNGLFELRQTIAHWLEKR 81  Psychrobacter a...
3JTX_A        83 YDGLT--V-DADNEILPVLGSREALFSFVQTVLN-PV-----------SdgiKPAIVSPNPFYQIYEGATLLGGGEIHFA 147 Neisseria menin...
WP_011398994  82 FNLAGg-V-DPESQVLPVNGTREALFAFAQAVIA-PT-----------Q---DALVVSPNPFYQIYEGAAYLAGAEPYFL 144 Hahella chejuensis
WP_011332680  82 FNVPSgwI-DPARNVLPVNGTREALFAFTQTVVN-RG-----------D---DALVVSPNPFYQIYEGAAFLAGAKPHYL 145 Pseudomonas flu...
WP_010960767  82 FDLGEggV-DPERQVLPVNGTREALFAFAQAVID-PA-----------E---QPLVLMPNPFYQIYEGAAILAGAEPFFL 145 Methylococcus c...
WP_002808767  83 FHLPTg-AaDPERHILPVNGTREALFAIAHCVID-SS-----------R---APLVVMPNPFYQIYEGAALLAGAQPYYI 146 Nitrosococcus o...
WP_004927518  81 FQLNH--I-SSEDHILPVTGTREGIFSFVQALIN-RD-----------E---APYVVMPNPFYQIYEGATLLAGAKPYFI 142 Acinetobacter
WP_011239427  82 YGLPA--V-DVATQVLPVNGSREALFAFAQCVVDsRG-----------G---AAKVLCPNPFYQIYEGAALLAGAEPVFL 144 Aromatoleum aro...
WP_011505868  81 YALPPgsL-DPERHVLPVNGTREAIFAFVQAALD-RT-----------R---PAKVAMPNPFYQIYEGATLLAGGEPVYL 144 Chromohalobacte...
WP_002225352  82 YDGLT--V-DADNEILPVLGSREALFSFVQTVLN-PV-----------SdgiKPAIVSPNPFYQIYEGATLLGGGEIHFA 146 Neisseria menin...
WP_012607243  86 FTLPAgfL-DPEQHIIPANGSREALFSIAQAVLP-PC-----------Qt-pKPLVLLPNPFYQIYEGAALLAGAEPYFL 151 Acidithiobacill...
WP_011279699  82 FFLNH--V-NPNTQVLPVMGTREAIFSIVQAVIN-HQtetisqtatlnQ---SPVVVMPNPFYQIYEGAAILAQATPYFI 154 Psychrobacter a...
WP_011398994  82 FNLAGg-V-DPESQVLPVNGTREALFAFAQAVIA-PT-----------Q---DALVVSPNPFYQIYEGAAYLAGAEPYFL 144 Hahella chejuensis
WP_011332680  82 FNVPSgwI-DPARNVLPVNGTREALFAFTQTVVN-RG-----------D---DALVVSPNPFYQIYEGAAFLAGAKPHYL 145 Pseudomonas flu...
WP_010960767  82 FDLGEggV-DPERQVLPVNGTREALFAFAQAVID-PA-----------E---QPLVLMPNPFYQIYEGAAILAGAEPFFL 145 Methylococcus c...
WP_002808767  83 FHLPTg-AaDPERHILPVNGTREALFAIAHCVID-SS-----------R---APLVVMPNPFYQIYEGAALLAGAQPYYI 146 Nitrosococcus o...
WP_004927518  81 FQLNH--I-SSEDHILPVTGTREGIFSFVQALIN-RD-----------E---APYVVMPNPFYQIYEGATLLAGAKPYFI 142 Acinetobacter
WP_011239427  82 YGLPA--V-DVATQVLPVNGSREALFAFAQCVVDsRG-----------G---AAKVLCPNPFYQIYEGAALLAGAEPVFL 144 Aromatoleum aro...
WP_011505868  81 YALPPgsL-DPERHVLPVNGTREAIFAFVQAALD-RT-----------R---PAKVAMPNPFYQIYEGATLLAGGEPVYL 144 Chromohalobacte...
WP_002225352  82 YDGLT--V-DADNEILPVLGSREALFSFVQTVLN-PV-----------SdgiKPAIVSPNPFYQIYEGATLLGGGEIHFA 146 Neisseria menin...
WP_012607243  86 FTLPAgfL-DPEQHIIPANGSREALFSIAQAVLP-PC-----------Qt-pKPLVLLPNPFYQIYEGAALLAGAEPYFL 151 Acidithiobacill...
WP_011279699  82 FFLNH--V-NPNTQVLPVMGTREAIFSIVQAVIN-HQtetisqtatlnQ---SPVVVMPNPFYQIYEGAAILAQATPYFI 154 Psychrobacter a...
3JTX_A       148 NC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFD-GnkPLGCLQ 225 Neisseria menin...
WP_011398994 145 PCdAGNGFIPDFDSVPNSIWRRCQLLFLCTPGNPTGRVIPAEILKKLIALADEHSFIIASDECYSEIYFDeSaaPIGLLE 224 Hahella chejuensis
WP_011332680 146 PClDENGFNPDFDAVSPDIWKRCQILFLCSPGNPTGALIPVDVLKKLIALADEYDFVIAADECYSELYFDeQtpPPGLLS 225 Pseudomonas flu...
WP_010960767 146 NTtAESGFLPDFDAVPETVWRRCRLVYVCSPGNPTGAVMGDDQQRRLLELAERYDFIVASDECYSELYADeAdpPTGLLQ 225 Methylococcus c...
WP_002808767 147 NCtAENRFIPDYRAVPQQVWQRCQLLYLCSPGNPTGAVLDLETLAALIELAQRFDFIIAADECYSEIYLDeSnpPPGLLQ 226 Nitrosococcus o...
WP_004927518 143 NCtAENDYLGDFDAVPSEVWEKTALLFVCTPGNPTGAVLSKEKLKKLIQLSDQYNFVIASDECYSELWFDq--aPVGLLE 220 Acinetobacter
WP_011239427 145 NNlPENRFGSDFDSLPESVWRDVQLAFVCSPGNPTGRVLSLQEWARLFELSDRHGFVIAADECYSEIYFDeNapPVGALQ 224 Aromatoleum aro...
WP_011505868 145 DCpPANGCLPDLDAVPADTWRDVQLVFVCSPGNPTGAVAPLAEYRKLIALADEHDFIIASDECYSELYLDeHqpPAGLLE 224 Chromohalobacte...
WP_002225352 147 NC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFD-GnkPLGCLQ 224 Neisseria menin...
WP_012607243 152 NCdASG--QPNFLAIEESVWARCALLYINSPHNPTGATLSLETLGWLIRKARQYGFVLAADECYSELYPe-GqaPAGILE 228 Acidithiobacill...
WP_011279699 155 PCtADNGFKGDFRSVPKDVWMRTQLLFVCSPNNPTGSVMTMDDWEQLLRLSDQYGFIIASDECYSELYFDkA--PIGLLQ 232 Psychrobacter a...
WP_011398994 145 PCdAGNGFIPDFDSVPNSIWRRCQLLFLCTPGNPTGRVIPAEILKKLIALADEHSFIIASDECYSEIYFDeSaaPIGLLE 224 Hahella chejuensis
WP_011332680 146 PClDENGFNPDFDAVSPDIWKRCQILFLCSPGNPTGALIPVDVLKKLIALADEYDFVIAADECYSELYFDeQtpPPGLLS 225 Pseudomonas flu...
WP_010960767 146 NTtAESGFLPDFDAVPETVWRRCRLVYVCSPGNPTGAVMGDDQQRRLLELAERYDFIVASDECYSELYADeAdpPTGLLQ 225 Methylococcus c...
WP_002808767 147 NCtAENRFIPDYRAVPQQVWQRCQLLYLCSPGNPTGAVLDLETLAALIELAQRFDFIIAADECYSEIYLDeSnpPPGLLQ 226 Nitrosococcus o...
WP_004927518 143 NCtAENDYLGDFDAVPSEVWEKTALLFVCTPGNPTGAVLSKEKLKKLIQLSDQYNFVIASDECYSELWFDq--aPVGLLE 220 Acinetobacter
WP_011239427 145 NNlPENRFGSDFDSLPESVWRDVQLAFVCSPGNPTGRVLSLQEWARLFELSDRHGFVIAADECYSEIYFDeNapPVGALQ 224 Aromatoleum aro...
WP_011505868 145 DCpPANGCLPDLDAVPADTWRDVQLVFVCSPGNPTGAVAPLAEYRKLIALADEHDFIIASDECYSELYLDeHqpPAGLLE 224 Chromohalobacte...
WP_002225352 147 NC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFD-GnkPLGCLQ 224 Neisseria menin...
WP_012607243 152 NCdASG--QPNFLAIEESVWARCALLYINSPHNPTGATLSLETLGWLIRKARQYGFVLAADECYSELYPe-GqaPAGILE 228 Acidithiobacill...
WP_011279699 155 PCtADNGFKGDFRSVPKDVWMRTQLLFVCSPNNPTGSVMTMDDWEQLLRLSDQYGFIIASDECYSELYFDkA--PIGLLQ 232 Psychrobacter a...
3JTX_A       226 AAAQLGR-SRQKLLXFTSLSXRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAXSIPVQRASIAAWDDEQHVIDNRRLYQ 304 Neisseria menin...
WP_011398994 225 ACAELGRhDYRRCVVFHSLSKRSNVPGLRSGFVAGDANILREFLRYRTYHGCSMPIPTQLASIALWGDEEHVRQNRAQYV 304 Hahella chejuensis
WP_011332680 226 ACADLGRkDFKRCVVFHSLSKRSNLPGLRSGFVAGDADILKGFLLYRTYHGCAMPVQTQLASVAAWNDEVHVRANRALYR 305 Pseudomonas flu...
WP_010960767 226 TAATMGNtEFRRCVVFHSLSKRSNAPGLRSGFVAGDADILGRFLLYRTYHGCAMPLTVQKASERAWADEIHVRENRALYR 305 Methylococcus c...
WP_002808767 227 AAIHIGLdDFRRCLVFHSLSKRSNGPGLRSGFVAGDAHLIEQFLRYRTYHGCAMPPATQAASMAAWNDERHVIENRHRYR 306 Nitrosococcus o...
WP_004927518 221 VCAEIGRdNYKNCIVFHSLSKRSNLPGMRSGFVAGDAELLKPYLKFRTYHGAAMPVQHQLASIAAWNDEAHVEENRQQYR 300 Acinetobacter
WP_011239427 225 AAHQLGRgDFRNLVTFSSLSKRSNVPGMRSGFVAGDAAVLKAFLRYRTYHGCAMNPAVQAASVAAWNDEAHVVDNRRLYR 304 Aromatoleum aro...
WP_011505868 225 ACATMGRdDYRRCLVFHSLSKRSNLPGLRSGFVAGDAELIAPFKRYRTYHGCAMPLTTQQASIVAWGDEQHVRANRDAYR 304 Chromohalobacte...
WP_002225352 225 AAAQLGR-SRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRMYQ 303 Neisseria menin...
WP_012607243 229 AAAATG--SLAQVLAFHSLSKRSSIPGARSGFVAGDADILKAFVRYRTYLGAATPPFIQAAAIAAWQDEQHVHHTRADYA 306 Acidithiobacill...
WP_011279699 233 ACAALGRhDFKNCLVFHSLSKRSNLPGLRSGFVAGDATILDSYLQYRTYQGCAMPIPHQLASIAAWEDEKHVAHNRALYQ 312 Psychrobacter a...
WP_011398994 225 ACAELGRhDYRRCVVFHSLSKRSNVPGLRSGFVAGDANILREFLRYRTYHGCSMPIPTQLASIALWGDEEHVRQNRAQYV 304 Hahella chejuensis
WP_011332680 226 ACADLGRkDFKRCVVFHSLSKRSNLPGLRSGFVAGDADILKGFLLYRTYHGCAMPVQTQLASVAAWNDEVHVRANRALYR 305 Pseudomonas flu...
WP_010960767 226 TAATMGNtEFRRCVVFHSLSKRSNAPGLRSGFVAGDADILGRFLLYRTYHGCAMPLTVQKASERAWADEIHVRENRALYR 305 Methylococcus c...
WP_002808767 227 AAIHIGLdDFRRCLVFHSLSKRSNGPGLRSGFVAGDAHLIEQFLRYRTYHGCAMPPATQAASMAAWNDERHVIENRHRYR 306 Nitrosococcus o...
WP_004927518 221 VCAEIGRdNYKNCIVFHSLSKRSNLPGMRSGFVAGDAELLKPYLKFRTYHGAAMPVQHQLASIAAWNDEAHVEENRQQYR 300 Acinetobacter
WP_011239427 225 AAHQLGRgDFRNLVTFSSLSKRSNVPGMRSGFVAGDAAVLKAFLRYRTYHGCAMNPAVQAASVAAWNDEAHVVDNRRLYR 304 Aromatoleum aro...
WP_011505868 225 ACATMGRdDYRRCLVFHSLSKRSNLPGLRSGFVAGDAELIAPFKRYRTYHGCAMPLTTQQASIVAWGDEQHVRANRDAYR 304 Chromohalobacte...
WP_002225352 225 AAAQLGR-SRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRMYQ 303 Neisseria menin...
WP_012607243 229 AAAATG--SLAQVLAFHSLSKRSSIPGARSGFVAGDADILKAFVRYRTYLGAATPPFIQAAAIAAWQDEQHVHHTRADYA 306 Acidithiobacill...
WP_011279699 233 ACAALGRhDFKNCLVFHSLSKRSNLPGLRSGFVAGDATILDSYLQYRTYQGCAMPIPHQLASIAAWEDEKHVAHNRALYQ 312 Psychrobacter a...
3JTX_A       305 EKFERVIPILQQVFDVKLPDASFYIWLKVPd---GDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADV 381 Neisseria menin...
WP_011398994 305 RKFRSFKEILAPCWPLEAPDAAFYFWAQTP----IPDDAFAQRLYAEKNLTVLPGRFLGREQQDVNPGAGRVRMALVASV 380 Hahella chejuensis
WP_011332680 306 EKFDAVLAILSPVMDVQRPDGSFYLWPNVQ----GDDAAFCRDLFAEEHVTVVPGSYLSRDVDGVNPGAGRVRMALVAPL 381 Pseudomonas flu...
WP_010960767 306 RKFDAVATVLGDVLDLTVPSAGFYLWLRTP----IDDTAFAAGLFEAQNVTVLPGRFLSRPSGGVDPGTGYVRIALVAPL 381 Methylococcus c...
WP_002808767 307 EKFAAVLEILGSEISCSLPKASFYLWPETP----IPDTDFAQQLYQRENILTLPGRFLAREAHGTNPGEQRIRLALVAPL 382 Nitrosococcus o...
WP_004927518 301 AKFNLFQSELGQLIPLKKPDAGFYYWLHVD-----NDEAFAKMLMEKAHIKVLPGRYLSRETEQGNPGENHVRMALVADL 375 Acinetobacter
WP_011239427 305 EKFDRVTALVARHLKVERPDAGFYLWAQTP----IPDTEFARRLQGEYNVTVLPGSFLAREANGVNPGAGFVRIALVAPT 380 Aromatoleum aro...
WP_011505868 305 DKFAAVGEILAPVMDFPTPRASFYLWPAVPg---GDDEAFARDLFAEEHVTVLPGRYMSRAGENGDPGAGRVRLALVAEV 381 Chromohalobacte...
WP_002225352 304 EKFERVIPILQQVFDVKLPDASFYIWLKVPd---GDDLALARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADV 380 Neisseria menin...
WP_012607243 307 RKFAAAHDILGALLPIETPAGGFYLWPRV-----GDGEAFVRALYGAEHVRCLPGAYLAREAHGVHPGRDRVRIALVGSL 381 Acidithiobacill...
WP_011279699 313 EKFALWMSELGALLDLRMPEAGFYFWIKAPeqfdGDDELFVKALYEHANIHALAGRYLSREVNGKNPGQGYVRIALVASV 392 Psychrobacter a...
WP_011398994 305 RKFRSFKEILAPCWPLEAPDAAFYFWAQTP----IPDDAFAQRLYAEKNLTVLPGRFLGREQQDVNPGAGRVRMALVASV 380 Hahella chejuensis
WP_011332680 306 EKFDAVLAILSPVMDVQRPDGSFYLWPNVQ----GDDAAFCRDLFAEEHVTVVPGSYLSRDVDGVNPGAGRVRMALVAPL 381 Pseudomonas flu...
WP_010960767 306 RKFDAVATVLGDVLDLTVPSAGFYLWLRTP----IDDTAFAAGLFEAQNVTVLPGRFLSRPSGGVDPGTGYVRIALVAPL 381 Methylococcus c...
WP_002808767 307 EKFAAVLEILGSEISCSLPKASFYLWPETP----IPDTDFAQQLYQRENILTLPGRFLAREAHGTNPGEQRIRLALVAPL 382 Nitrosococcus o...
WP_004927518 301 AKFNLFQSELGQLIPLKKPDAGFYYWLHVD-----NDEAFAKMLMEKAHIKVLPGRYLSRETEQGNPGENHVRMALVADL 375 Acinetobacter
WP_011239427 305 EKFDRVTALVARHLKVERPDAGFYLWAQTP----IPDTEFARRLQGEYNVTVLPGSFLAREANGVNPGAGFVRIALVAPT 380 Aromatoleum aro...
WP_011505868 305 DKFAAVGEILAPVMDFPTPRASFYLWPAVPg---GDDEAFARDLFAEEHVTVLPGRYMSRAGENGDPGAGRVRLALVAEV 381 Chromohalobacte...
WP_002225352 304 EKFERVIPILQQVFDVKLPDASFYIWLKVPd---GDDLALARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADV 380 Neisseria menin...
WP_012607243 307 RKFAAAHDILGALLPIETPAGGFYLWPRV-----GDGEAFVRALYGAEHVRCLPGAYLAREAHGVHPGRDRVRIALVGSL 381 Acidithiobacill...
WP_011279699 313 EKFALWMSELGALLDLRMPEAGFYFWIKAPeqfdGDDELFVKALYEHANIHALAGRYLSREVNGKNPGQGYVRIALVASV 392 Psychrobacter a...
3JTX_A       382 ATCVKAAEDIVSLY 395 Neisseria meningitidis Z2491
WP_011398994 381 EECIEAAHRIKSFI 394 Hahella chejuensis
WP_011332680 382 AECVEAAERIRDFV 395 Pseudomonas fluorescens
WP_010960767 382 EECVVAAHRIKQFI 395 Methylococcus capsulatus
WP_002808767 383 EECVEAAWRIKNFV 396 Nitrosococcus oceani
WP_004927518 376 AQCEQVVQRLKKVL 389 Acinetobacter
WP_011239427 381 AECVEAAERIAAFC 394 Aromatoleum aromaticum
WP_011505868 382 EATVEAAYRIRRFI 395 Chromohalobacter salexigens
WP_002225352 381 ATCVKAAETIVSLY 394 Neisseria meningitidis
WP_012607243 382 EDCVEGLQRIRRFM 395 Acidithiobacillus ferrooxidans
WP_011279699 393 EESREAIRRIRQLL 406 Psychrobacter arcticus
WP_011398994 381 EECIEAAHRIKSFI 394 Hahella chejuensis
WP_011332680 382 AECVEAAERIRDFV 395 Pseudomonas fluorescens
WP_010960767 382 EECVVAAHRIKQFI 395 Methylococcus capsulatus
WP_002808767 383 EECVEAAWRIKNFV 396 Nitrosococcus oceani
WP_004927518 376 AQCEQVVQRLKKVL 389 Acinetobacter
WP_011239427 381 AECVEAAERIAAFC 394 Aromatoleum aromaticum
WP_011505868 382 EATVEAAYRIRRFI 395 Chromohalobacter salexigens
WP_002225352 381 ATCVKAAETIVSLY 394 Neisseria meningitidis
WP_012607243 382 EDCVEGLQRIRRFM 395 Acidithiobacillus ferrooxidans
WP_011279699 393 EESREAIRRIRQLL 406 Psychrobacter arcticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap