3R5A


Conserved Protein Domain Family
DapD_gpp

?
TIGR03536: DapD_gpp 
Click on image for an interactive view with Cn3D
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (DapD) is involved in the succinylated branch of the "lysine biosynthesis via diaminopimelate (DAP)" pathway (GenProp0125). This model represents a clade of DapD sequences most closely related to the actinobacterial DapD family represented by the TIGR03535 model. All of the genes evaluated for the seed of this model are found in genomes where the downstream desuccinylase is present, but known DapD genes are absent. Additionally, many of the genes identified by this model are found proximal to genes involved in this lysine biosynthesis pathway.
Statistics
?
PSSM-Id: 211834
Aligned: 7 rows
Threshold Bit Score: 612.578
Threshold Setting Gi: 499825132
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3R5A_A         8 LFSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAAVAPILGYAAGNQALTFTSQQAYQLADALKGI-DAAQSALLSRLA 86  Pseudomonas aer...
WP_011469083   4 LYGLGLGVGTQNKKGEWLEVFFPQPTLNPEATLAQTLATAVGYEGGNQAITLDADKLNAIEAAATEQgFSELAALAAQFK 83  Saccharophagus ...
WP_011219604   3 SFSIALGTATKNRDGKIIEAFFPTPALNPSEELVKAVAAVVSYKEGNQSIEVTPAQCADLTVIFQAAgDEKSAQFAAKAS 82  Photobacterium ...
WP_011398997   1 MLAFGIGVGAKNSKGDWLETYFAAPLWNPAAEVKELLKDSLGYAGGNQTLELDAQKLEALAIAFEKAsLPAQAQTAKALR 80  Hahella chejuensis
WP_004574732   5 LFSLAFGVGSQNRQGAWLEVFYAQPLLNPSAELVAAVAPVLGYEGGNQAIAFSNAQAAQLAEALKGV-DAAQAALLTRLA 83  Pseudomonas putida
WP_011505866   1 MLSFALGIGHQNTQGEWLDVYYPTPLLNPDDALVAAAREALAAPAGNAAVSFLPEHCQALSSALHQAgAAEQAELAEAFA 80  Chromohalobacte...
WP_011588421   4 YFAIALGCGTKNRKDNWLEVFYPDPSLNPDNKLIDVIREELDYQGGNAALELTHRQVQHIAREWREAgFEHEASYAVAFQ 83  Alcanivorax bor...
WP_011469083   4 LYGLGLGVGTQNKKGEWLEVFFPQPTLNPEATLAQTLATAVGYEGGNQAITLDADKLNAIEAAATEQgFSELAALAAQFK 83  Saccharophagus ...
WP_011219604   3 SFSIALGTATKNRDGKIIEAFFPTPALNPSEELVKAVAAVVSYKEGNQSIEVTPAQCADLTVIFQAAgDEKSAQFAAKAS 82  Photobacterium ...
WP_011398997   1 MLAFGIGVGAKNSKGDWLETYFAAPLWNPAAEVKELLKDSLGYAGGNQTLELDAQKLEALAIAFEKAsLPAQAQTAKALR 80  Hahella chejuensis
WP_004574732   5 LFSLAFGVGSQNRQGAWLEVFYAQPLLNPSAELVAAVAPVLGYEGGNQAIAFSNAQAAQLAEALKGV-DAAQAALLTRLA 83  Pseudomonas putida
WP_011505866   1 MLSFALGIGHQNTQGEWLDVYYPTPLLNPDDALVAAAREALAAPAGNAAVSFLPEHCQALSSALHQAgAAEQAELAEAFA 80  Chromohalobacte...
WP_011588421   4 YFAIALGCGTKNRKDNWLEVFYPDPSLNPDNKLIDVIREELDYQGGNAALELTHRQVQHIAREWREAgFEHEASYAVAFQ 83  Alcanivorax bor...
3R5A_A        87 ESQKPLVATLLAEDAAPSSTAEAYLKLHLLSHRLVKPHAVNLSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLLE 166 Pseudomonas aer...
WP_011469083  84 TSSRPLVAVLLAEDAAPTSVAEGYFKLQLLSHRLVKPHNTNLTGVFGVLPNVAWTNVGAIDLEELPARQLEARLNGETIS 163 Saccharophagus ...
WP_011219604  83 QSSQTLIIVILATDAAPTSVSEGFLKLQLISHRLVKPHGVVLDGIFGLLHNIAWTNKGPIDLPELAERQMDARLNGEVII 162 Photobacterium ...
WP_011398997  81 DSKRPTVAVIIEADDKASSTPEVYLKLQLISHRFVKPHGINLEGIFALLPNVAWTSQGAIDIDELSSRQLTARANGETLR 160 Hahella chejuensis
WP_004574732  84 ESHKPLVATLLAEDAALSSTPEAYLKLHLLSHRLVKPHGVSLAGIFPLLPNVAWTNQGAVDLGELAELQLEARLKGELLE 163 Pseudomonas putida
WP_011505866  81 AAQRPLVAVFLDEDSAPASVPEVYLKLHLLSHRLVKPHGVKLDGMFGLLKNIAWTNEGPIDIDELAARRLKARLEGRPLT 160 Chromohalobacte...
WP_011588421  84 ESDRPVVLTVLETDAEPATTPEAYLKLHLISHRLAKPHGVNLSGIFPLLPNVAWTNEGAVDLEELPERQLLARLNGKVLE 163 Alcanivorax bor...
WP_011469083  84 TSSRPLVAVLLAEDAAPTSVAEGYFKLQLLSHRLVKPHNTNLTGVFGVLPNVAWTNVGAIDLEELPARQLEARLNGETIS 163 Saccharophagus ...
WP_011219604  83 QSSQTLIIVILATDAAPTSVSEGFLKLQLISHRLVKPHGVVLDGIFGLLHNIAWTNKGPIDLPELAERQMDARLNGEVII 162 Photobacterium ...
WP_011398997  81 DSKRPTVAVIIEADDKASSTPEVYLKLQLISHRFVKPHGINLEGIFALLPNVAWTSQGAIDIDELSSRQLTARANGETLR 160 Hahella chejuensis
WP_004574732  84 ESHKPLVATLLAEDAALSSTPEAYLKLHLLSHRLVKPHGVSLAGIFPLLPNVAWTNQGAVDLGELAELQLEARLKGELLE 163 Pseudomonas putida
WP_011505866  81 AAQRPLVAVFLDEDSAPASVPEVYLKLHLLSHRLVKPHGVKLDGMFGLLKNIAWTNEGPIDIDELAARRLKARLEGRPLT 160 Chromohalobacte...
WP_011588421  84 ESDRPVVLTVLETDAEPATTPEAYLKLHLISHRLAKPHGVNLSGIFPLLPNVAWTNEGAVDLEELPERQLLARLNGKVLE 163 Alcanivorax bor...
3R5A_A       167 VFSVDKFPKMTDYVVPAGVRIADTARVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTM 246 Pseudomonas aer...
WP_011469083 164 VDCVDKFPKMTNYVVPKGVRIAHTARVRLGAYVGEGTTVMHEGFINFNAGTLGTSMVEGRISAGVVVGNGSDLGGGCSTM 243 Saccharophagus ...
WP_011219604 163 VDCVDKFPKMVDYIVPTGIRIADTSRVRLGAHVGEGTTVMHEGFINFNAGTTGVSMVEGRISAGVMVGEGSDIGGGASIM 242 Photobacterium ...
WP_011398997 161 IFSVDKFPQMTDYVVPKGVRIADTARVRLGAYVGEGTTIMHEGFVNFNAGTEGASMIEGRISAGVMIGEGSDLGGGCSTM 240 Hahella chejuensis
WP_004574732 164 VFSVDKFPKMTDYVVPAGVRIADTARVRLGAYIGEGTTIMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTM 243 Pseudomonas putida
WP_011505866 161 VDCVDKFPKMADYVVPKGVRIGDTARVRLGAYLGEGTTVMHEGFCNFNAGTEGPGMVEGRISAGVTIGKGSDLGGGCSTM 240 Chromohalobacte...
WP_011588421 164 VNSVDKFPKMTDYVVPAGVRIADTSRVRLGAYVGEGTTIMHEGFINFNAGTEGPGMIEGRISAGVFVGKGSDIGGGASTM 243 Alcanivorax bor...
WP_011469083 164 VDCVDKFPKMTNYVVPKGVRIAHTARVRLGAYVGEGTTVMHEGFINFNAGTLGTSMVEGRISAGVVVGNGSDLGGGCSTM 243 Saccharophagus ...
WP_011219604 163 VDCVDKFPKMVDYIVPTGIRIADTSRVRLGAHVGEGTTVMHEGFINFNAGTTGVSMVEGRISAGVMVGEGSDIGGGASIM 242 Photobacterium ...
WP_011398997 161 IFSVDKFPQMTDYVVPKGVRIADTARVRLGAYVGEGTTIMHEGFVNFNAGTEGASMIEGRISAGVMIGEGSDLGGGCSTM 240 Hahella chejuensis
WP_004574732 164 VFSVDKFPKMTDYVVPAGVRIADTARVRLGAYIGEGTTIMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTM 243 Pseudomonas putida
WP_011505866 161 VDCVDKFPKMADYVVPKGVRIGDTARVRLGAYLGEGTTVMHEGFCNFNAGTEGPGMVEGRISAGVTIGKGSDLGGGCSTM 240 Chromohalobacte...
WP_011588421 164 VNSVDKFPKMTDYVVPAGVRIADTSRVRLGAYVGEGTTIMHEGFINFNAGTEGPGMIEGRISAGVFVGKGSDIGGGASTM 243 Alcanivorax bor...
3R5A_A       247 GTLSGGGNIVISVGEGCLIGANAGIGIPLGDRNIVEAGLYITAGTKVALLDEQNALVKVVKARDLAGQPDLLFRRNSQNG 326 Pseudomonas aer...
WP_011469083 244 GTLSGGGNIIISVGEECLLGANAGIGIPLGDRCTVESGLYITAGTKVAVLDDKNQLAETVKARDLAGKSDLLFRRNSVNG 323 Saccharophagus ...
WP_011219604 243 GTLSGGGKMVISIGENCLLGANAGLGFPMGDRCTIESGLYVTAGTKVRMLDNEGKEVEIAKARDLAGKADLLFRRNSITG 322 Photobacterium ...
WP_011398997 241 GTLSGGGAIIISVGKNSLIGANAGIGIPLGDRCKVEAGLYITAGSKVAVMDDKGEVAKVVKARELAGQNDLLFRRNSETG 320 Hahella chejuensis
WP_004574732 244 GTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRNTVEAGLYITAGTKVNLLDENNELVKVVKARDLAGQTDLLFRRNSLNG 323 Pseudomonas putida
WP_011505866 241 GTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRCTVEAGLYVTAGAKIAVLDDKGELVQTVSGRDLAGQSDLLLRRNSQNG 320 Chromohalobacte...
WP_011588421 244 GTLSGGGNIIISLGEGCLLGANAGTGIPLGDRCTIEAGLYITSGSKVQLLDDKGEIVNTVKARDLAGQSDLLFRRNTTNG 323 Alcanivorax bor...
WP_011469083 244 GTLSGGGNIIISVGEECLLGANAGIGIPLGDRCTVESGLYITAGTKVAVLDDKNQLAETVKARDLAGKSDLLFRRNSVNG 323 Saccharophagus ...
WP_011219604 243 GTLSGGGKMVISIGENCLLGANAGLGFPMGDRCTIESGLYVTAGTKVRMLDNEGKEVEIAKARDLAGKADLLFRRNSITG 322 Photobacterium ...
WP_011398997 241 GTLSGGGAIIISVGKNSLIGANAGIGIPLGDRCKVEAGLYITAGSKVAVMDDKGEVAKVVKARELAGQNDLLFRRNSETG 320 Hahella chejuensis
WP_004574732 244 GTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRNTVEAGLYITAGTKVNLLDENNELVKVVKARDLAGQTDLLFRRNSLNG 323 Pseudomonas putida
WP_011505866 241 GTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRCTVEAGLYVTAGAKIAVLDDKGELVQTVSGRDLAGQSDLLLRRNSQNG 320 Chromohalobacte...
WP_011588421 244 GTLSGGGNIIISLGEGCLLGANAGTGIPLGDRCTIEAGLYITSGSKVQLLDDKGEIVNTVKARDLAGQSDLLFRRNTTNG 323 Alcanivorax bor...
3R5A_A       327 AVECKTNKTAIELNEALHAHN 347 Pseudomonas aeruginosa
WP_011469083 324 AVECKTNKTAIALNEELHANN 344 Saccharophagus degradans
WP_011219604 323 QIECLTNKSAVELNSELHSNN 343 Photobacterium profundum
WP_011398997 321 RIEVVTNKTAIQLNEALHANN 341 Hahella chejuensis
WP_004574732 324 AVECKTHKSAIELNEALHAHN 344 Pseudomonas putida
WP_011505866 321 RIECLTNKSAVALNEALHAHN 341 Chromohalobacter salexigens
WP_011588421 324 AVQCLTNKSAIALNEELHKHN 344 Alcanivorax borkumensis
WP_011469083 324 AVECKTNKTAIALNEELHANN 344 Saccharophagus degradans
WP_011219604 323 QIECLTNKSAVELNSELHSNN 343 Photobacterium profundum
WP_011398997 321 RIEVVTNKTAIQLNEALHANN 341 Hahella chejuensis
WP_004574732 324 AVECKTHKSAIELNEALHAHN 344 Pseudomonas putida
WP_011505866 321 RIECLTNKSAVALNEALHAHN 341 Chromohalobacter salexigens
WP_011588421 324 AVQCLTNKSAIALNEELHKHN 344 Alcanivorax borkumensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap