Conserved Protein Domain Family
DapD_Ac

?
TIGR03532: DapD_Ac 
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
This enzyme is part of the diaminopimelate pathway of lysine biosynthesis. Alternate name: tetrahydrodipicolinate N-acetyltransferase. Note that IUBMB lists this alternate name as the accepted name. Unfortunately, the related succinyl transferase acting on the same substrate (EC:2.3.1.117, TIGR00695) uses the opposite standard. We have decided to give these two enzymes names which more clearly indicated that they act on the same substrate.
Statistics
?
PSSM-Id: 132571
View PSSM: TIGR03532
Aligned: 7 rows
Threshold Bit Score: 356.756
Threshold Setting Gi: 488196169
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011230549   6 ANEIISFIQNSKKSTPVKVYIKGDLEGIDFGSSAKTFITGNVGVVFGEWQDIQAAIEANQDKIEDYVVENDRRNSAIPLL 85  Geobacillus
WP_003641534   6 AQSIINYIGSAKKKTPVKVYVKGALDQLNVPAGIKTFFSGNAGVLFGDWADVEPFLKANAANIEDYELENDARNSAVPMA 85  Lactobacillus p...
WP_003546878   6 AKSIIEYIGNAPKKTPVKVFIKGNLDQLNFPNTIENFTEQHSGIIFGDWKDVEPFLNDNKEKIVQYRIENDVRNSAVPLI 85  Lactobacillus a...
WP_012048152   8 PYEIARYIKEAKKSTPIKAYIEGDLSNCDF-TNIEKFNSGDLYILFGESEEILVIIEKNKDKIKNCRIEQDRRKSAIPLL 86  Clostridium bot...
WP_002485048   7 AQEIIQYISDAKKSTPLKVYVNGHFENVTFPESFKVFGSEHSKVIFCEANEWKQFYQQNHSLITELEIEMDRRNSAIPLK 86  Staphylococcus ...
WP_009609870  13 AYEIARYIKEAKKSTPVKAYVQGKI-QVEEEEGLKIFGSEDFKILIGELEVVEKVIEQNKDRIKYYHLEYDRRNSAIPLL 91  Caldanaerobacte...
WP_002267377   8 AQEIIAFIGNAEKKTNVKVTFEGAL-AAALPENVVKLGN----VLFGDWKDIEPLL-ANLTENKDYVVEQDGRNSAVPLL 81  Streptococcus m...
WP_011230549  86 DLKGIKARIEPGAIIRDHVEIGDNAVIMMGAVINIGAVVGEGTMIDMNAVLGGRATVGKNCHIGAGAVLAGVIEPPSAKP 165 Geobacillus
WP_003641534  86 DLKQYNARIEPGAIIRDQVLIGDNAVIMMGAVINIGAEIGEGSMIDMGAILGGRAIVGKNCHIGAGTVLAGVVEPPSAKP 165 Lactobacillus p...
WP_003546878  86 DLKKFNARIEPGAIIRDQVAIGKNAVIMMGAIINIGAEIGDDTMIDMGVVLGGRAIVGKHCHIGAGSVLAGVIEPASAKP 165 Lactobacillus a...
WP_012048152  87 DMLKINARIEPGATIRDKVIIGENAVIMMGAVVNIGAEIGEGTMVDMNAVVGARGKLGKNVHLGAGAVVAGVLEPPSSDP 166 Clostridium bot...
WP_002485048  87 DLTNTNARIEPGAFIREQAIIEDGAVVMMGATINIGAIVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASP 166 Staphylococcus ...
WP_009609870  92 DITHLDARIEPGAIIRDKVKIGKNAVIMMGAVINIGAEIGENSMIDMNAVIGARGIIGKNVHVGAGAVIAGVLEPPSSVP 171 Caldanaerobacte...
WP_002267377  82 DKRNINARIEPGAIIRDQVTIEDNAVVMMGAIINIGAEIGEGTMIDMGAILGGRATVGKNSHIGAGAVLAGVIEPASADP 161 Streptococcus m...
WP_011230549 166 VVIEDDVLVGANAVILEGVTVGKGAVVAAGAVVVEDVPPYTVVAGVPARVIKQIDEQTRAKTEIKQELRQL 236 Geobacillus
WP_003641534 166 VQIDDDVLIGANAAVLEGVHVGKGAVVAAGAIVIEDVAPNTVVGGVPARKLKDIDDKTKSKTELMAELRNL 236 Lactobacillus plantarum
WP_003546878 166 VQIDDDVVIGANAVVIEGIHVGKGAVIAAGAIVTKDVEPYTMVAGVPAKVIKKVDNKTLDKTGLEDDLRKI 236 Lactobacillus acidophilus
WP_012048152 167 CTIEDNVLIGANAVILEGVKIGKGSVVAAGSIVTTDVPENVVVAGAPAKIIKEVDVKTKDKTKLLDDLRK- 236 Clostridium botulinum
WP_002485048 167 VVIEDNVLIGANAVILEGVRVGAGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQTSEVQDSKREIVSALRKL 237 Staphylococcus epidermidis
WP_009609870 172 VVIEDNVMIGANAVILEGVRVGRGAVVAAGSVVIEDVPPNTVVAGVPAKIVKVVDEKTREKTKLMEDLRG- 241 Caldanaerobacter subterr...
WP_002267377 162 VRIGDNVLVGANAVIIEGVQVGSGSVVAAGAIVTQDVPDNVVVAGVPARVIKEIDEKTQQKTALEDALRNL 232 Streptococcus mutans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap