Conserved Protein Domain Family
GldJ_short

?
TIGR03530: GldJ_short 
gliding motility-associated lipoprotein GldJ
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldJ is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldJ abolish the gliding phenotype. GldJ is homologous to GldK. This model represents the GldJ homolog in Cytophaga hutchinsonii and several other species which is of shorter architecture than that found in Flavobacterium johnsoniae and is represented by a separate model (TIGR03524). Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132569
View PSSM: TIGR03530
Aligned: 2 rows
Threshold Bit Score: 793.077
Threshold Setting Gi: 499906100
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAXU:1101174000279_ALPR1_01515  10 MWTAAMVIVAGSILTSCNKtpgyGRRTANKPGKTSATTGAEFsfeeNDSTNFFVAKNAEQIPGPNLKFIQGGRAVLGTQE 89  Algoriphagus machipongonensis...
WP_011586834                         8 IKHAVVLVAGASLLFSCSK----GNPTSINPGGSSTTTGMAF----NEENGFQVSDYAGQPEGPNLVYIEGGRTVLGSFE 79  Cytophaga hutchinsonii...
WGS:AAXU:1101174000279_ALPR1_01515  90 EDVMAFRDNLERTVTISNFYMDETEITNNDYREFLFNMKKNVSADSILKLEPSEDVWSGEMSFNDLYQSYYFRFPGFNFY 169 Algoriphagus machipongonensis...
WP_011586834                        80 EDLMKNGDNVERTVTVASFYMDETEIANIHWLEYLFYVQRDSSQEFYESALPDTTVWASELAYNDPYVDHYFRYPGFRYF 159 Cytophaga hutchinsonii...
WGS:AAXU:1101174000279_ALPR1_01515 170 PVAGVSWVQANAYSKWRTEYVQELVREERGIDSSFTKNQL-IERGVAMADFRLPNEGEWEYAAKAMIGTQYLDENQEYGR 248 Algoriphagus machipongonensis...
WP_011586834                       160 PVVGVNWIQANDYCIWRTTVVNNQLAQNAGIDVPEGGGRIpLESGVVLPNYRLPSEAEWEYAAQALIGNQWLDENQTHKR 239 Cytophaga hutchinsonii...
WGS:AAXU:1101174000279_ALPR1_01515 249 IYPWDGRGVRNPYnvkrkGKQ-GDFLANFKRGRGDYAGIAGnQRNDGEILPTNVYDMAPNDFGLYHMAGNMNEWVYDVYR 327 Algoriphagus machipongonensis...
WP_011586834                       240 LYPWDGHALRNPY-----GKQmGMFLANFKRGRGDYAGIAG-KLNDGAMITTYIYEFPPNDFGLYCMAGNVNEWVYDVYR 313 Cytophaga hutchinsonii...
WGS:AAXU:1101174000279_ALPR1_01515 328 PLSYQDFDDLNPLRKDGSFDEIENYE----TSMLSDEFRVYKGGSWKDVAYWLSPGTRRFMHQDSATNAIGFRCAMISIG 403 Algoriphagus machipongonensis...
WP_011586834                       314 PLSFQTFDDLNPLRRNGFLDEEKGYDkagfQSLVDDHVRVYKGGSWKDVAYWMSPGTRRYLAEDSCTATIGFRCAMIQAG 393 Cytophaga hutchinsonii...
WGS:AAXU:1101174000279_ALPR1_01515 404 EK 405 Algoriphagus machipongonensis
WP_011586834                       394 TN 395 Cytophaga hutchinsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap