Conserved Protein Domain Family
selenium_YgeY

?
TIGR03526: selenium_YgeY 
putative selenium metabolism hydrolase
SelD, selenophosphate synthase, is the selenium donor protein for both selenocysteine and selenouridine biosynthesis systems, but it occurs also in a few prokaryotes that have neither of those pathways. The method of partial phylogenetic profiling, starting from such orphan-selD genomes, identifies this protein as one of those most strongly correlated to SelD occurrence. Its distribution is also well correlated with that of family TIGR03309, a putative accessory protein of labile selenium (non-selenocysteine) enzyme maturation. This family includes the uncharacterized YgeY of Escherichia coli, and belongs to a larger family of metalloenzymes in which some are known peptidases, others enzymes of different types.
Statistics
?
PSSM-Id: 132565
View PSSM: TIGR03526
Aligned: 5 rows
Threshold Bit Score: 705.792
Threshold Setting Gi: 499712414
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002391692   3 FNAVNAAAEGYREDMVKFLRDLVKIPGESAEEGNKIARAKAEMEKLGFDKIDIDPQGNLLGYMGSGEKLIAFDGHMDTVG 82  Enterococcus fa...
WP_005301172   7 FEMVLEKAYQYKAEMTQFLRDMIAIPSESCDEERVVLRIKQEMEKVGFDKVEIDPMGNVLGYIGHGPHLIAMDAHIDTVG 86  Aeromonas
WP_012047945   6 KEEILKLAEKYKPEMSRFLRDMARIPSESCDEKGVILRIKEEMEKVGFDKVEIDPMGNVLGYIGHGKHVIAMDAHIDTVG 85  Clostridium bot...
WP_011188626   2 FNNIKDRSKFYAQNIYDFASTLIQTESFSGDEGRVAQLVAEKMRALDFDKVEIDEMGNVCGSVGHGPKLICVDAHMDVVG 81  Desulfotalea ps...
WP_011393148   6 IAQIKSEVAKYRGDIIRFLKDIVAIPSPNGDIKAVAERIGQEMRKLGFDDVFLDSMGNIVGRIGSGPRVLLYDSHIDTVD 85  Moorella thermo...
WP_002391692  83 IGEMSNWKFDPYDGYETETEIGGRGTSDQEGGIVSAIYGAKIMKDLGLLsEKYTALVTVTVQEEDCDGLCWQYIIKEDGI 162 Enterococcus fa...
WP_005301172  87 VGNMANWTFDPYEGMEDHEIIGGRGASDQEGGMASMVYAGKIIKDLGLE-DEYTLLVTGTVQEEDCDGLCWQYIIEQSKI 165 Aeromonas
WP_012047945  86 IGDRNLWNYDPYEGYEDDEIIIGRGVTDQEGGMASMVYAGKIIKDLGLE-DDYTLIVTGTVQEEDCDGLCWQYIVNEDKI 164 Clostridium bot...
WP_011188626  82 YGDEKQWHQSPTSGAQDEKNIYGRGAADMKASIASMLYAGKILKDLDLL-EDFTYMVCTTVQEEPCEGLAWEFLIEKKGL 160 Desulfotalea ps...
WP_011393148  86 IADSDQWQWDPYKGKEENGIFYGLGAGDEKNSTPGMVYGLKIIKDLGLA-DDFTLYYFGNIEEI-CDGVAPNSLVVTDKI 163 Moorella thermo...
WP_002391692 163 RPEFVVSTEPTDGGIYRGQRGRMEIKVDVKGVSCHGSAPERGDNAIYKMADILQDVRALNNNgdtestairglvRM-LDP 241 Enterococcus fa...
WP_005301172 166 RPEFVVSTEPTDCQIYRGQRGRMEIRVEVQGVSCHGSAPERGDNAIFKMGPILGELQELSHN------------LG-NDD 232 Aeromonas
WP_012047945 165 KPEFVVITEPTSLNIYRGHRGRMEIKVTTHGISCHGSAPERGDNAIFKMAPILNELKALNEN------------LK-DDE 231 Clostridium bot...
WP_011188626 161 QPDFVILAEPSNDEISLAQKGRMEFKISVSGLSAHASTPHKGKNAIYKMARIITELEQLNDN------------LEiEDP 228 Desulfotalea ps...
WP_011393148 164 KPDFVVIGEPTKMNIYRGHRGRVEMKVTTKGRTCHASAPERGVNAVYKMAEIIKGISQMGAD------------FV-EDP 230 Moorella thermo...
WP_002391692 242 kynpewqearFLGRGTVTVSQIFHSSPSRCAVADGCTVSLDRRMTAGETWESCLEEIRNLPAVKkyGDDVTVSMYNYDRP 321 Enterococcus fa...
WP_005301172 233 ----------FLGKGTLTVSEIFFTSPSRCAVADSCAVSIDRRLTWGETWQGALDEIRALPAVQ--AAGAEVSMYQYDRP 300 Aeromonas
WP_012047945 232 ----------FLGKGTLTVSEIFFSSPSRCAVADGCTISVDRRLTDGETWEYAIQQIKNLPSVK--AAKAEVEMYSYERP 299 Clostridium bot...
WP_011188626 229 ----------ELGKGTLVVSEISAHAPSRCSVADYCEISIDRRLTWGESPKYALDQVKQLPAVQ--EAEARVEFFTFSEP 296 Desulfotalea ps...
WP_011393148 231 ----------FLGKGSIAVTDIHCKTPSINALPDECVIYIDRRLTFGETQEMAVEQVRKVAEPH--G--GKVEVLEFDEP 296 Moorella thermo...
WP_002391692 322 SYTDLTYEIECYFPTWVIPENHDVTKALMETHKNLYGETrkgsvetvemreerPLLDKWTFSTNGVSIMGRNGIPCIGFG 401 Enterococcus fa...
WP_005301172 301 AYTGLVYPTECYFPTWKVEEDHITVKTLSKAYTQLFNKA--------------PVVDKWTFSTNGVSIMGRHGIPVIGFG 366 Aeromonas
WP_012047945 300 SYTDLVYPTECFFPTWVLKEDHPICETAVKCYKDLFKSE--------------PKVDKWTFSTNAVSIMGRYGIPCIGFG 365 Clostridium bot...
WP_011188626 297 SYTGKPCQKECIFPAWKLEKEHRITKSALMAYRELFAKE--------------GTLTTWPFSTNGVGIMGKHQIPVIGYG 362 Desulfotalea ps...
WP_011393148 297 SYTGFVFKVDKYFPAWVLPEDHLLVKAGLETYQRVFGQP--------------TGVGKWVFSTNGIYWMGKAGIPAIGFG 362 Moorella thermo...
WP_002391692 402 PGAEAQAHAPNEKTWKDDLVRCAAVYAALPTVYCG 436 Enterococcus faecalis
WP_005301172 367 PGKEPEAHAPNEKTWKEHLVKCAAMYAVIPMLYLA 401 Aeromonas
WP_012047945 366 PGHEDQAHAPNERTWKEELVKAAAMYALIPITYVK 400 Clostridium botulinum
WP_011188626 363 PGTLDACHVPNEYVAKEQVLKATQMYAAIPIIYLQ 397 Desulfotalea psychrophila
WP_011393148 363 PGDEVYAHSVLDQVPIEDVVRSTEFYAYFPTVlre 397 Moorella thermoacetica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap