Conserved Protein Domain Family
GldJ

?
TIGR03524: GldJ 
gliding motility-associated lipoprotein GldJ
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldJ is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldJ abolish the gliding phenotype. GldJ is homologous to GldK. There is a GldJ homolog in Cytophaga hutchinsonii and several other species that has a different, shorter architecture and is represented by a separate model. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132563
View PSSM: TIGR03524
Aligned: 3 rows
Threshold Bit Score: 956.327
Threshold Setting Gi: 85821014
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ZP_01062279    3 RNLVFKTLVFGLSTMLLVSCGrngKDYKNSSRATGWSIND-RDGGFQANTDyKEQEAAPGLIFIEGGTFTMGRVQDDVMH 81  Leeuwenhoekiell...
EAQ42161       1 MKNIFKITFIVFVSLLFVNCK---SSSSNKSRLTGLSFNDpKNGNYIRANSfDGQETPLGMVGVEGGSFTMGQVQDDVMF 77  Polaribacter sp...
WP_012023633   5 KIVVLQLMMSMVLMLGTASCSk-kSSSSHASRATGWDVDS-QNGTAARNAG-KKQQAGPGLVFVEGGTFTMGKVQDDVMH 81  Flavobacterium ...
ZP_01062279   82 DWNNTPTQQHVQSFYMDETEVTNLMYLEYLDYLKRVFPPEEANYRNIYYGALPDTLVWRNRLGFNETMTENYLRHPAYAR 161 Leeuwenhoekiell...
EAQ42161      78 DWNTTPNKIHVRSFYMDEAEVTNSEYFLYVQYMKDVFPPSEAKYKNIYSSILPDTLVWRKSLGNTDILSENYFRHPAYAD 157 Polaribacter sp...
WP_012023633  82 DWNNTPTQQHVQSFYMDETEVTNGMYLEYLEWLKKVFPPTEENYKNIYEGASPDTLVWRNRLGYNETMTNNYLRHPSYAN 161 Flavobacterium ...
ZP_01062279  162 YPVVGVSWIQAVEFSTWRTNRYNEYVLEQEGFTQKGAKYn-VDAQSTFDTDTYLQAPSLTYGGQDDVIRGGKASERREKN 240 Leeuwenhoekiell...
EAQ42161     158 YPVVGVSWLQANEYCKWRTNAVNLKTLIDKGNIKNIFDI--DTISNFFDTDVFLVDDSKLFDGDTTVYKRGIGRTVRKRG 235 Polaribacter sp...
WP_012023633 162 YPVVGVNWIQAVEFSKWRTDRVNEAVLEKNGYLKKGAKTndVTAESLFNTEAYVASPSTTYGGNEELVLKKNPNGRRPKA 241 Flavobacterium ...
ZP_01062279  241 NTPRPnpnnpgstgeaKDIYVQMK----DGIIStTKYRLPTEAEWEYAALGLVGLREYNVYRGRKKYPWDGAYTRSGNRR 316 Leeuwenhoekiell...
EAQ42161     236 EARPA-----------KDAFQGRKitnaDGVLT-QRFRLPTEAEWEFAAKANVENREYNNIRGRKKYAWNGKYTRAKNKR 303 Polaribacter sp...
WP_012023633 242 GKDGVvp-------eeKNVYAQRS----SGIIL-PEYRLPTEAEWEYAAAADVGQREYNIYKGQKKYPWSGDYTRSNKRK 309 Flavobacterium ...
ZP_01062279  317 NRGDQLANFKQGDGDYGGIAGWSDDNADITAPIKSYEPNDYGLYDMAGNVSEWVADVYRPIVDDEYNDFNYYRGNVYTKN 396 Leeuwenhoekiell...
EAQ42161     304 NRGDQLANFKQGKGDYSGPSGWSSDGADIPNEIKSYPPNGFGLYDMSGNVAEWVADVYRPIIDNEANDFNYFRGNLFTKK 383 Polaribacter sp...
WP_012023633 310 NRGDQLANFKQGNGDYGGIAGWSDDGADITNAVKSYAANDFGLYDMAGNVAEWVADVYRPIIDNEANDFNYYRGNQYAKN 389 Flavobacterium ...
ZP_01062279  397 AITEDGTVKVLTTE---DIVYDTLENGKIVARGLPGEIAQVPVDDEETYLRTQFSESDNRNFRDGDKQSSRYYQsfsD-- 471 Leeuwenhoekiell...
EAQ42161     384 MIDSKGNVVFAGEQggaEIEYDTLPNGKVVPRYLPGSIKYVPITKNDATLRRNFSKADNANIGDGDANSTRFYE---Dde 460 Polaribacter sp...
WP_012023633 390 KIGKDGKIEIVSTA---TIKYDTLSNGKVVARNLPGEIAQVPVDEQETYLRTNFSTSDNINYRDGDKQSSRYFDf-gDse 465 Flavobacterium ...
ZP_01062279  472 -ADSDSDRMYDSPINRI-REGEEG-MIKEYDKENDRTTLVDDEVRVYKGGSWRDREYWLDPAQRRYLPQTMATDDIGFRN 548 Leeuwenhoekiell...
EAQ42161     461 dEIARRPSMYNSPKSPTvEIDPVTgREVLVNDDKKRTTLISDRTRVYKGGSWSDREYWLDPAQRRYLPEYMATNYIGFRC 540 Polaribacter sp...
WP_012023633 466 sGSKADQAMYNSPKHNI-TTDSLGkMIRKYDNSSKRTTLIDDKVRVYKGGSWRDRAYWLDPAQRRYFPQDMATDYIGFRC 544 Flavobacterium ...
ZP_01062279  549 AMSRVGSKSTKNKTPRN 565 Leeuwenhoekiella blandensis MED217
EAQ42161     541 VTDKLGPLSNGKRKARN 557 Polaribacter sp. MED152
WP_012023633 545 AMSRVGAKTERRKSPRN 561 Flavobacterium johnsoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap