Conserved Protein Domain Family
GldA_ABC_ATP

?
TIGR03522: GldA_ABC_ATP 
gliding motility-associated ABC transporter ATP-binding subunit GldA
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132561
View PSSM: TIGR03522
Aligned: 5 rows
Threshold Bit Score: 505.848
Threshold Setting Gi: 490707040
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011584931   1 MSVIVKDLVKIYGKQYAVDGISFTAEKGRITGFLGPNGAGKSTTMKVATCFIPPSSGTIEVCGYSVLESPIEVRRNIGYL 80  Cytophaga hutch...
WP_002703617   1 MSVVVSDLTKTFGVQNAVDQVSFEAQPGDIVGFLGPNGAGKSTTMKIITGYLPPTAGSVAVCGSDVTQNSMEVRKNIGYL 80  Microscilla marina
WP_012023594   1 MSIEVNSISKSYGEQKALNEISFKIEKGEIVGFLGPNGAGKSTLMKILTTYLLADSGSALVNGHDVMTNAKAVQQSIGYL 80  Flavobacterium ...
WP_008203132   1 MSLRVSQLTKLYGTQKALDEVTFEANPGRILGFLGPNGAGKSTTMKIITGYLAADGGSVQVMGEDALQAPKKVSPFIGYL 80  Algoriphagus sp...
WP_004570379   9 MSINVVSVSKKYTTENVLDSVSFAAQKGQIIGFLGPNGAGKSTMMKILTGYLKPDSGAVFVDEIDVLKDSLEAQRILGYL 88  Polaribacter ir...
WP_011584931  81 PEHNPLYLDMYVQEYLQFIGGMYGMKDTALKKRVAQMIELCGLGVEQYKKLGALSKGYRQRAGLAQALIHDPQVLILDEP 160 Cytophaga hutch...
WP_002703617  81 PEHNPLYLDMYVKEYLRFIGALHGLKGRKLKQQVAAMVELCGLQREQHKKIGAISKGYRQRVGLAQSIIHDPKVLILDEP 160 Microscilla marina
WP_012023594  81 PEHNPLYLDLYVREYLAFNADVYKVP----KSRIEEVIQLTGLTPESHKKISQLSKGYRQRVGLANALLHNPDVLILDEP 156 Flavobacterium ...
WP_008203132  81 PEHNPLYLDMYVREFLEFSAGIYGMSGQLKNQRVKELLEKVGLRPEQHKKIGQLSKGYRQRVGLAKALIHDPKVVILDEP 160 Algoriphagus sp...
WP_004570379  89 PEHNPLYEEMYVREYLQFQATIYKVE----KEQIEKCIAQVGLVGEAHKKINELSKGFQQRVGLAAAILHNPTVLILDEP 164 Polaribacter ir...
WP_011584931 161 TTGLDPNQILEIRKVIKSIAKDKTVIFSTHIMQEVQALCDQVIIINRGKIVADKTITEIRNF-NTsIKIIRLEFTEQVDI 239 Cytophaga hutch...
WP_002703617 161 TTGLDPNQIVEIREVIKNIGQAKTVIFSTHIMQEVQAMCNRVIIINLGKIVADGNVDSLKAMqNK-ANAFITEFKEEIDW 239 Microscilla marina
WP_012023594 157 TTGLDPNQLMEIRNVIKNIGKDKTIFLSTHIMQEVEAICDRVIIIDKGQIVADNKLDHLVAA-DK-EQVIEVEFDYQIEE 234 Flavobacterium ...
WP_008203132 161 TTGLDPNQLVEIRNLIAEIAVDKTMILSTHIMQEVEAICQDVVIINKGKILASDALENLSIA-EQ-KVQLLIETEEALEL 238 Algoriphagus sp...
WP_004570379 165 TTGLDPNQLVAIRALIKMLGKDKTILLSTHVMQEVEAVCDRVIIIKKGRIVLDKKLLEL-QQ-NA-TQVIEVIFNVPIDA 241 Polaribacter ir...
WP_011584931 240 QAFKIFDFVSDARHMQGNAYELVVATHADTRPLIFKACADKGWTLIEMKVEEQSLESVFRELT 302 Cytophaga hutchinsonii
WP_002703617 240 KLIGELEGVIEVQPLGGGKYKVFAQPETDVRPLMFELAKTHHWTLVGLQQQENTLEDVFQNLT 302 Microscilla marina
WP_012023594 235 QLLAKLENIASYKNTHDMTWELTFITDKDMRPAIFDFANENGLKTLQLNQKNKNLEAVFREIT 297 Flavobacterium johnsoniae
WP_008203132 239 SWFETLGEISFGKK-GSSSLIISCEDPNETRKEAMKIIQQKGLNLISMNQNKKNLEQIFRDIT 300 Algoriphagus sp. PR1
WP_004570379 242 QVFSVFKKLNSVINTVGNTWKLTFDNQEDMRSEVFDLAQVNGFKILSLQTHRKNLETLFREIT 304 Polaribacter irgensii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap