Conserved Protein Domain Family
ABC_perm_GldF

?
TIGR03518: ABC_perm_GldF 
gliding motility-associated ABC transporter permease protein GldF
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldF is believed to be a ABC transporter permease protein (along with ATP-binding subunit, GldA and a sunstrate-binding subunit, GldG) and is linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldF abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132557
View PSSM: TIGR03518
Aligned: 10 rows
Threshold Bit Score: 281.119
Threshold Setting Gi: 86142999
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EAS72527                             1 MLAIFLKEFNSFFSSAIGFVVAGLFLLATGVLVWVLPGSfNIFDQGYANLTPFFEVLPWIFCVLIPAICMRSFSEEKKQG 80  Psychroflexus torquis ATCC 700755...
WGS:AAXU:1101174000288_ALPR1_19973   1 MKSLFLKEINAFFGSLLGYLILALFLVAIGLIVWVFPES-SVLDYGYADLEPLFTYTPYVFTFLVPAIAMRSIAEERKSG 79  Algoriphagus machipongonensis...
EAY25027                             1 MLTIFKKEFNSFLSSLIAYIVIIVFLTGIGLFMWVFPST-NVLDYGYADLESLFSLAPYVFMFLIPAITMRTFAEEKKTG 79  Microscilla marina ATCC 23134...
ZP_01061421                          1 MFAILKKEFHSFFASPVGYLVIGLFLVLNALFLWVFDNDfNLFDYGFADLTPFFQLVPWIFIFLIPAVTMRSFSDELRLG 80  Leeuwenhoekiella blandensis MED217...
EAP86032                             1 MYAILKKDIQTFFSSTIGYLVIAVFLIVNGLFLWVFQGDfNVFNYGFAELSSYFRLAPWVLLFLIPAVTMRSIAEERKQG 80  Croceibacter atlanticus HTCC2559...
EAQ40980                             1 MYPILKKEFTSFFASPIAYLVIGVFLLINGLFLFVFNDDfNILNAGFADVTPFFYLAPWVFLFLIPAITMKSFADEYNTG 80  Polaribacter sp. MED152...
EAS19176                             1 MKAIYLKELRSYFSSITGYLVIAIFLLVTSLFLFVFDGEfNILNYGFADLSPFFLLVPWLFIFLIPAVTMRSFTIERNLG 80  Flavobacteria bacterium BBFL7...
EAR15361                             1 MFAVFKKEFSSFFSSPVGYLVMGIFLVITGLFLWVFRGPfNIIDYGFADLSLFFLLAPWAFLLLIPAVCMRSFAEERKLG 80  Robiginitalea biformata HTCC2501...
WP_012024783                         1 MKSIILREIKSFFGSPIGYLVIAIFLISNGLFLWVFEGDyNILNTGYADLTPFFTLTPWILIFLIPAVTMRSFSDERKQG 80  Flavobacterium johnsoniae...
WP_011584932                         1 MWSIFRKEIAVFLNSLIAYLVILVFLTFIGVFMWVLPAS-SILDYGYAEMDTLFSYGPLAFLLLIPAITMRSFAEEKKDG 79  Cytophaga hutchinsonii...
EAS72527                            81 TLELLLTKPISINQLIAGKFLGSFSLSVIALLPTLFYIISISALSAEGVQVDYGVIFSSYVGVFLLMSCFTSIGTFASCL 160 Psychroflexus torquis ATCC 700755...
WGS:AAXU:1101174000288_ALPR1_19973  80 TWELLRTSPLSLIQIILVKYLALLFLVILAVIPTLLYFFTIIQLGDPVGNLDQAGFFGSWIGLLMIGSVFASVGLFASSL 159 Algoriphagus machipongonensis...
EAY25027                            80 TMELLFTRPLTDWDILLGKYLASLALVIFALLPTLIYFFSVYCLGNPVGNIDISGTMGSYFGLILLGAVFTSIGLFASVL 159 Microscilla marina ATCC 23134...
ZP_01061421                         81 TLELLLTRPITTLELVLGKFLGALVLLLLALLPTLVYVYAIDQLGNPQGNYDLGILAGSYLGLLFLATAYCAIGVFASTL 160 Leeuwenhoekiella blandensis MED217...
EAP86032                            81 TLELLLTKPISSMQLILGKYFGALSLIVIAILPTLVYVWTIYALGNPTGNLDLGVILTSYIGMLLLASTFVAIGLFASSV 160 Croceibacter atlanticus HTCC2559...
EAQ40980                            81 TIELLKTNPISDWKIVLGKFFASLLLVIIAIVPTFTYIFTVYELGNPVGNIDFGSTIGSYLGLLFLASTYTAVGLFTSTL 160 Polaribacter sp. MED152...
EAS19176                            81 TLEMIFTRPISHRSIIAGKYLAGVTLIIIALIPTILYVYTIGQLGETVNNLDIGSTVGSYAGVLLLVLCYVAIGIFCSSV 160 Flavobacteria bacterium BBFL7...
EAR15361                            81 TLELLLSRPVSTGRLVLGKFLGVCALIGVTLLPTLLYVLAVHQLGATAGNLDTGLVWGSYAGLLLLMGLYAAIGLFASSL 160 Robiginitalea biformata HTCC2501...
WP_012024783                        81 TLELLLTKPLSIWQIVNGKFLGSFFLIILAIIPTFIYVKVISSLGSPEGNIDMGSTIGSYFGLLFLIASYSAIGIFTSTL 160 Flavobacterium johnsoniae...
WP_011584932                        80 TIELLLTKPLSDWQLLLGKYLSACTLVALALIPTVLYYISVYQLGKPVGNIDSAAVGSSYIGLFLLGCVYTSAGIFASSI 159 Cytophaga hutchinsonii...
EAS72527                           161 TDNSLIAFVIGTFLSVLLYFGSVGVSSIpLWDSQLYTLEYFSLSHHFQSISRGILDSRNLIYFISISLFFLVLTHLQLKS 240 Psychroflexus torquis ATCC 700755...
WGS:AAXU:1101174000288_ALPR1_19973 160 TSQQVLAFVLGVFLCFVLYFGFSALADL-QVGNVAYWVEELSLSFHYINLSRGVIDSGDVFFMLGMNWLFLGLSVLTLRN 238 Algoriphagus machipongonensis...
EAY25027                           160 TESQIVSFIIALFLCFLFHEGFGYLANVrDTSDFSYYIVQWGISYHYETIRKGLIDSRNLVYFFSMITVMLLATKLVLGS 239 Microscilla marina ATCC 23134...
ZP_01061421                        161 SENQIVAFLIAVFISFLFYYGFNGIAET----LNIDFLRSLSLQRHFESIGRGVLDSRDLIYFLSVTSVFIALTVFKLES 236 Leeuwenhoekiella blandensis MED217...
EAP86032                           161 TQNQLVAFIIAVLICFLMFYGFDGISSQ-LINESSFNLSFFGLQYHYDSLGRGVLDTRDLIYFISITVLFIALTHFNIKR 239 Croceibacter atlanticus HTCC2559...
EAQ40980                           161 SKNQIVAFILSVFITFILFYGFDAIANS--FGSNGFTIQQLGINEHFKSISRGVIDTRDVIYFLSVTFFFLFITKTRLDN 238 Polaribacter sp. MED152...
EAS19176                           161 TSNQIIAFLLAAVLCFIMYFGFEGFSTV----IENDGISYLGLKYHYESMARGVIDTRDVIYFLSIAILFFALSELSLKI 236 Flavobacteria bacterium BBFL7...
EAR15361                           161 TENQIAAFMLAVAGCFLFYQGFDSLATLfPDGGTALFIRELGIRAHYEAIGQGIVDSRDLLYFISLGVFFLFLTTRRLNA 240 Robiginitalea biformata HTCC2501...
WP_012024783                       161 SENQIVAFIIAVFICFLFYFGFEGLASL--VPGQSNIISAFGMQDHFKSMSRGVIDTRDVIYFLSISVLFLSFTVYQLKS 238 Flavobacterium johnsoniae...
WP_011584932                       160 STNQIVSFIIALLLCYLIYSGFDHLASLdLWEGSAVTLLPFGLDYHYNALSKGVVDSRNVCYFLTVIGIMLLSTKIILES 239 Cytophaga hutchinsonii...
EAS72527                           241 N 241 Psychroflexus torquis ATCC 700755
WGS:AAXU:1101174000288_ALPR1_19973 239 K 239 Algoriphagus machipongonensis
EAY25027                           240 R 240 Microscilla marina ATCC 23134
ZP_01061421                        237 K 237 Leeuwenhoekiella blandensis MED217
EAP86032                           240 Y 240 Croceibacter atlanticus HTCC2559
EAQ40980                           239 E 239 Polaribacter sp. MED152
EAS19176                           237 I 237 Flavobacteria bacterium BBFL7
EAR15361                           241 Y 241 Robiginitalea biformata HTCC2501
WP_012024783                       239 F 239 Flavobacterium johnsoniae
WP_011584932                       240 R 240 Cytophaga hutchinsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap