Conserved Protein Domain Family
ppisom_GldI

?
TIGR03516: ppisom_GldI 
peptidyl-prolyl isomerase, gliding motility-associated
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
Statistics
?
PSSM-Id: 132555
View PSSM: TIGR03516
Aligned: 6 rows
Threshold Bit Score: 267.398
Threshold Setting Gi: 88780846
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EAS19664       1 MKKHLAIplfkailLLFVLVTYGCK-TPEPRKPISRTTSSTTE-LSIENNKQIYAAEEAAIEKVIA-GLDQKFERSTYGF 77  Flavobacteria b...
EAR14103       1 MKTRFAV-------IALLLLALGCG-EPEVRWPVSRQGGSFLK-LSAERNKRLLEQEQALLDRIIEaDSQHTYLTSQSGS 71  Robiginitalea b...
ZP_01061313    1 MNKIVSA-------ILLVLFAVGCK-TPEARRPVSHSSGSYID-ASIARNKKLNKAEENAIKELMAqNPEVEYFTSEKGF 71  Leeuwenhoekiell...
EAP86499       1 MKHLINL-------ILVAVIFGSCK-PPEARRPISSSSGTTIE-ASVLRNKKLIANQESQIKNIISkDSINTYETSSNGF 71  Croceibacter at...
EAR12025       1 MMHKIVV-------FLLLFILLSCA-NSQPRRPINPKPSTTSFqKSVEASKRLIEFEESEILRFISrDTILNYKTSANGF 72  Polaribacter ir...
WP_012024435   1 MNYLKISiy----sLLFAVLLAGCKhHEEARRPISRASGTFMK-KSADRNKKLVASEEDVIKKIIKsNPKVKYYATKKGY 75  Flavobacterium ...
EAS19664      78 YYAFTQKDSIEGKTPVFGDRVTFEYNVIALNGDTIYSKEELSPLTKSMEQe-YGIFRGMRDALKLMQTGEEATFYFPSYT 156 Flavobacteria b...
EAR14103      72 RYYYLQQAPGDGYTPQPDDLVTLTYDIRTWDNDSIYPETEIGLVRYKVDK--QELFPGLRNSVKLLQEGESAVFFFPSSL 149 Robiginitalea b...
ZP_01061313   72 WYYYNKRDTSAVLTAETGDLVSFEYEINALDGTPIVTKTELGPQTYQIEQsnQDLISGLKDGLKLMKEGETVTFLLPSHK 151 Leeuwenhoekiell...
EAP86499      72 WYYFKTQDTTSQKMPEFGDLVSYDYTIESLSGDTIYSEEETPSKTYAMDQ--EQLASGIREGLKLTTEGDEIVLLLPSHK 149 Croceibacter at...
EAR12025      73 WYAYNTKIDGQTTTPKTGDLVEFYYDIRNLKNSVIYAKEELGIRTYKIDQ--EDFISGIQKGIKLMKVGETITFVIPSYN 150 Polaribacter ir...
WP_012024435  76 WFSYDEKNNTETTAPRKGDIAYFNLEVKDIEGKVIYSEADLGPQTYYVDK--QDIMMGLRDGIKYMKKNETVTFLFPSHM 153 Flavobacterium ...
EAS19664     157 GYGYYGDQDRIGTNVPFKSDVKLLGINI 184 Flavobacteria bacterium BBFL7
EAR14103     150 AFGYHGDQERIGPNLPVQSTLTIVKIEK 177 Robiginitalea biformata HTCC2501
ZP_01061313  152 AFGYYGYEDKIGSNLPIQTRVTLNDIKP 179 Leeuwenhoekiella blandensis MED217
EAP86499     150 AYGYYGDKNKIGSNIPITVKLKVKSITT 177 Croceibacter atlanticus HTCC2559
EAR12025     151 AFGVFGDGNKIEMNTTIISTVTLLNNKN 178 Polaribacter irgensii 23-P
WP_012024435 154 AYGYHGDNKKIGPNQSLICTVTLRNFVP 181 Flavobacterium johnsoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap