Conserved Protein Domain Family
GldC

?
TIGR03515: GldC 
gliding motility-associated protein GldC
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldC do not abolish the gliding phenotype but do impair it. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Statistics
?
PSSM-Id: 132554
View PSSM: TIGR03515
Aligned: 5 rows
Threshold Bit Score: 156.132
Threshold Setting Gi: 5360169
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD42889       5 IKSEIKFNVELDENRVPEKLTWSAQDGGVLAE-EAKAIMLSIWDSKAQETMRIDLWTKDMPVDEMKIFFHQTLVAMADTF 83  Flavobacterium ...
WP_011584337   2 KNSEIKFSVTLDDKNIPESILWEATDGPSDKPlPTDAIALSLWDHSQMNTMQINIWTKEMPVEEMKRFAIEGIGGMADSI 81  Cytophaga hutch...
WP_008237367   2 KKAEIKITVELDDNNVPDNILWESTDAKTQEQvPVKSMMLALWDHNYKNSMRIDLWTKDMPVDEMKRFFYETLQTMGDSF 81  Pedobacter sp. ...
WP_008200749   2 KKSDIKFQIELDEKSLPKAITWDATDKESHGQeSTKSISLNIWDNLNQSTLRIDLWTEEMSMVEMKRFYIDILGGMGQTI 81  Algoriphagus sp...
WP_002694601   2 RKEDININVTLDDANVCEQILWMATNTPDQGTnGSKAMSLSFWDEDGKGTAKMDLWTKKMEIHEMKAFCIETIAGLADTV 81  Microscilla marina
AAD42889      84 KRATDDEKMSDTMKDFCDYFAEKLELTK 111 Flavobacterium johnsoniae UW101
WP_011584337  82 ENATGDIKMAEMIRDLCKKLVIHVKENA 109 Cytophaga hutchinsonii
WP_008237367  82 LKATGEKLIIEDLRDYCAHFADKMGIDM 109 Pedobacter sp. BAL39
WP_008200749  82 LNSTGDEYMSEEIKALCDRLVTHVNEEN 109 Algoriphagus sp. PR1
WP_002694601  82 RQATNDEAMAMDIDDLCRRLSQRLKQEM 109 Microscilla marina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap