Conserved Protein Domain Family
GldD_lipo

?
TIGR03512: GldD_lipo 
gliding motility-associated lipoprotein GldD
Members of this protein family are found a number of Bacteriodetes lineage bacteria, including both species such as Flavobacterium johnsoniae, which possess a poorly understood form of rapid gliding motility, and other species which apparently do not. Mutation of GldD blocks both this motility and chitin utilization in the model species, Flavobacterium johnsoniae. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 132551
View PSSM: TIGR03512
Aligned: 3 rows
Threshold Bit Score: 284.123
Threshold Setting Gi: 499906287
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011711418   2 RKLILAFIGISFLFSSCKND---VQPKPKAFLALEYPEAKYDQVDIGCPYIFDKNMLAKVap--sRNRIPCWIQLDYENM 76  Gramella forsetii
WP_012023616   4 KILSVTAILLTLTVVSCKDD---VLPKPAGFLRLDYPEAKYVNFENNCPFVFQMNEDAVI-----KGEKDCGFAITYPKM 75  Flavobacterium ...
WP_011587021   4 NIFVLSILGLLILVSSCSNEenaFMPKPKGFNKIDLPAHRYDTLTGDYPYTFEYSSIAKIvpdttKTAEPYWIDIYYPEY 83  Cytophaga hutch...
WP_011711418  77 KGSIFITYQPVKNN---LDSLLTDAQKLPLQHTIKADVIEGDVYTNKLHSTYGM-FYEVDGDAASQAQFYLTDSTNHFLT 152 Gramella forsetii
WP_012023616  76 KATIYLTYKPVNGN---IEKLLKDAQKLTYEHVIKADDILEQPYINPEKKVYGM-FYQVDGNAATNSQFYVTDSTKHFIA 151 Flavobacterium ...
WP_011587021  84 KANIQITYKKTNNNpktLEEYIKDSHTLANKHNVKAYAIDE--LITDTKNGYAVkVFELSGDVPSQIQFHVTDSTKNFLR 161 Cytophaga hutch...
WP_011711418 153 GSVYFQSLPNFDSIVPAAEYLKKDIRHLMESLRWS 187 Gramella forsetii
WP_012023616 152 GSVYFYAKPNFDSIMPAASYIKNDMQRIMETLKWK 186 Flavobacterium johnsoniae
WP_011587021 162 GAVYFRTSTKNDSLAPVISYMKEDVMHLIETLKFK 196 Cytophaga hutchinsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap