Conserved Protein Domain Family
FliI_clade3

?
TIGR03498: FliI_clade3 
flagellar protein export ATPase FliI
Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Statistics
?
PSSM-Id: 163293
View PSSM: TIGR03498
Aligned: 15 rows
Threshold Bit Score: 643.201
Threshold Setting Gi: 499184310
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010920876  18 GRVAAVNGLLIEVRGGLTRLAVGARVEIERFGQ----KPLPAEVVGFRETRALLMPFGPVEGVGPGAEIRI--V-PEGAV 90  Caulobacter vib...
WP_011511753  30 GRVVGVRGLMVEIAGPIHAMSVGARILIETGGD----RVIPAEVVGFNGDNAVVMPFAGLDGVRRGCRAVI--A-NASSQ 102 Nitrobacter ham...
WP_011383071  22 GQIAAVQGMLLEAGGVQRTISVGDRCNVVARDG----RRVICEVVGFRQGRALLMPYSPIEGIGLGCRTEV--Q-DAEPV 94  Magnetospirillu...
WP_011388284  22 GRVVGVQGMLVEIGGAQTNLSVGDRCAVIARDG----RPITCEVIGFRAARALLMPFSVLDGVGLGCRAEV--I-EGVPA 94  Rhodospirillum ...
WP_011253216  21 GSVKDVIGLCLTVIGLEGFITIGDRVAVKALDG----RVVQSEVVGFQGDVARLMSFGPLDGIGPGCEARIplN-RHDGG 95  Gluconobacter o...
WP_003599594  27 GRVTAIRGLLVEVAGPVSAMRLGGRIDVVVEGAgvaaSTVPCEVIGFAGDRALAMPFGSLEGVRRGCPALV--RdEAAGA 104 Methylobacteriu...
WP_002660657  22 GRVQKIKGLLVESLGPQCA--IGDLCLIDQRNG----KKVCAEVLGFNGPYVSLMAYEGFSGIEVGNKVYS--L-NKGLE 92  Lyme disease sp...
WP_011471555  25 GVVSEVTPTYYRVAGLSRYVRLGELIGLDVDNQ-----IQLGEVVRIDGTGVTAKPFDSHVAAGLGLVAY---R-LPPKT 95  Rhodopseudomona...
WP_006015095  29 GTVSDVSRSSIAVRGLSRDARLGDMVAIRAGEG----APSLAEIIRVADLQVLVKPFDDRIMPSLGAAVF---E-EGPLR 100 Brucella ovis
WP_012752121  27 GPVREVTASAARVAGVSAFVRLGDRMGFSA-DG----RTQVGEVVRIDAAGATVKPFESRIEAGIGSLAH---R-IGPAQ 97  Methylobacteriu...
WP_010920876  91 VRPTKAWLGRIINAFGEPIDGLGPLPQGEVPYPLKTPPPPAHARGRVGERLDLGVRSMNVFTTTCRGQRLGIFAGSGVGK 170 Caulobacter vib...
WP_011511753 103 VRPAPSWLGRVLNAMGEPIDGKGALPQGPVPVPFRNSPPPAHSRKRVGKPLDLGVRALNTFLTCCRGQRLGIFAGSGVGK 182 Nitrobacter ham...
WP_011383071  95 VFPDRGWLGRVINGFGEPVDGLGPLPGGDTAYPVKAQPPSAHSRSRVSGKIDLGLRSVNAFLTCCRGQRMGIFAGSGVGK 174 Magnetospirillu...
WP_011388284  95 IYPTRDWLGRVINAMGEAVDGKGALPAGERAVAIRGRPPSAHSRQRVGGKLDLGVRAINTFLTCCRGQRMGIFAGSGVGK 174 Rhodospirillum ...
WP_011253216  96 LGVNESWLGRVLDPLGQPIDGKGPLFPSFERQPVQCPPPNAASRARLGERIDLGVRALDTFTTCRRGQRLGLFAGSGVGK 175 Gluconobacter o...
WP_003599594 105 IRPSAAWLGRTVDALGRPIDGLGPLAQGPAIYPLRADPPPAHGRRRVGPPLDLGVRCINTFLTMCRGQRMGIFAGSGVGK 184 Methylobacteriu...
WP_002660657  93 INLSDELLGRVIDSLGRPIDNKGSFLNNSYKELIF-EKINPINRSIFEDQILTGVKVLDGFLPVAKGQRVGIFSGSGVGK 171 Lyme disease sp...
WP_011471555  96 LSPHPSWKGRVVNALGEPLDDAGVLQAGERVMSTDANPPPAMSRTRVQAPLHTGVRVVDLFTPLCIGQRIGIFAGSGVGK 175 Rhodopseudomona...
WP_006015095 101 IRPAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARVDRGLRTGVNVIDIFTPLCFGQRIGIFAGSGVGK 180 Brucella ovis
WP_012752121  98 LRPDPRWKGRVIDALGRPIDGLGPLAEGPASVPLDADPPAAMTRARVKTPLPTGVRAIDLFTPLCAGQRIGIFAGSGVGK 177 Methylobacteriu...
WP_010920876 171 SVLLSMLAKEATCDAVVVGLIGERGREVREFVEETLGEEGLRRAVVVVATSDEPALTRRQAAYMTLAISEFMRDQDQEVL 250 Caulobacter vib...
WP_011511753 183 SVLLSMLARNADADISVIGLVGERGREVQEFLQDDLGEEGLARSVVVVATSDEPALMRRQAAYLTLAVAEYFRDEGKDVM 262 Nitrobacter ham...
WP_011383071 175 SSLMSMMARNTSADISVLGLIGERGREAREFIEDDLGPEGMKRSVVVVSTSDESPLMRRQAAYMTLTVAEFFRDQGLDVL 254 Magnetospirillu...
WP_011388284 175 SSVMSMFIRNTNADVIVMGLVGERGREAREFIEDDLGEEGLKRAVTVVATSDESPLMRRQAAYMTLAVAEYFRDQGLDVL 254 Rhodospirillum ...
WP_011253216 176 STLLSMLARGADCDVAVISLVGERGREVREFIEDDLGPEGLARSVLVIATSDSPPLMRREAALSAMAIAEYFRNQGKSVL 255 Gluconobacter o...
WP_003599594 185 SVLLSMLARYTAADVAVIGLVGERGREVQEFLQDDLGAAGLAHSVVVVATSDEPVLMRRNAAYVTLAVAEYFRDQGAQVL 264 Methylobacteriu...
WP_002660657 172 STLLGMIAKNSNADVNVIAFIGERGRELNEFIEHELGEERLKKSVLVVSTSDESPISRYKGAYVATMIAEYFREQGKDVA 251 Lyme disease sp...
WP_011471555 176 TTLLSMLAQSSGFDTVVTALVGERGREVREFLEEALVHH-RSRAITVVSTSDESPMMRRLAAKTATTIAEYFRDRGESVL 254 Rhodopseudomona...
WP_006015095 181 STLLAMMTRAADFDTVVLALTGERGREVREMLEETMAGH-LGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVL 259 Brucella ovis
WP_012752121 178 STLLAMLAGAQGFDSVVVALVGERGREVREFLEGPIAAA-RDRAVIVVSTGDESPMMRRQAPKVALAVAESFRDRGESVL 256 Methylobacteriu...
WP_010920876 251 CLMDSVTRFAMAQREIGLAAGEPPTTKGYTPTVFTELPKLLERAGPGpIRPDGTtaapITALFTVLVDGDDHNEPIADAT 330 Caulobacter vib...
WP_011511753 263 CMMDSVTRFAMAQREIGLSTGEPPTTKGYTPTVFTELPRLLERAGPG-AADKGT----ITGIFTVLVDGDDHNEPVADAV 337 Nitrobacter ham...
WP_011383071 255 CMMDSVTRFAMAQREISLSAGEPPASKGYTPTVFAELPRLLERAGPG-V-GKGS----ITGLFTVLVDADDHNEPIADAV 328 Magnetospirillu...
WP_011388284 255 CLMDSVTRFAMAQREISLSAGEPPASKGYTPTVFAELPKLLERAGPG-VEGSGS----ITGLFTVLVEGDDHNEPISDAV 329 Rhodospirillum ...
WP_011253216 256 LLMDSVTRFCMALREIGLSAGEPPATRGYPPSVFAELPRLLERAGPG-YADQGM----ITALFTVLVEGDDQNEPVADAV 330 Gluconobacter o...
WP_003599594 265 CMIDSITRFAMAQRDIGLAGGEPPTAKGYTPTVFSELPRLLERAGPG-V-GEGA----ISGLFTVLVEGDDHNEPVADAV 338 Methylobacteriu...
WP_002660657 252 LLFDSITRFANAKREMSLSLGEPPVAKGYPPSVFVEIPILLERSGF--NGNGGS----VTGFYTVLVEGDDFTEPVADNI 325 Lyme disease sp...
WP_011471555 255 LIVDSVTRFAHAAREVALATGEPAIARGYAPSVFSELPRLLERSGPG-LDGQGS----ITGIFAVLVDGDDHNEPVADTV 329 Rhodopseudomona...
WP_006015095 260 LIVDSVTRFAHAAREVAIAAEEPPVARGYTPSVFSQLPRLLERAGPGsAEAGGS----ITGIYSVLVDGDDHNDPVSDTI 335 Brucella ovis
WP_012752121 257 LIVDSVTRYAHAARDVALAAGEPAVARGYPPSVFSDLPRLLERAGPG-AEGTGT----ITGIFSVLVDGDDHNDPVADSI 331 Methylobacteriu...
WP_010920876 331 RGILDGHIVMERAIAERGRFPAINVLKSISRTMPGCQHPHERDIVKGARQVMSAYSNMEELIRIGAYRAGADPVVDRAIR 410 Caulobacter vib...
WP_011511753 338 RGILDGHIVMQRAIAERGRYPAINVLKSVSRTMPKSADPAFLPVITRGRQVMATFSDMEELIRLGAYRTGSNAEVDEAIR 417 Nitrobacter ham...
WP_011383071 329 RGILDGHIVLDRSIAERGRYPAINILRSVSRTMPGCNNQQENDLVRRARSLLSTYEDMAELIRLGAYRRGTDPKVDEAIH 408 Magnetospirillu...
WP_011388284 330 RGILDGHIVLDRAIAERGRYPAINILRSVSRTMPGCNSPAENALVAKGRRLMAAYENMAELIRLGAYRKGSDPETDTAIH 409 Rhodospirillum ...
WP_011253216 331 RGILDGHIILDRKIGEQGRYPAIDVLRSLSRAVPGCNSPEENALTQRARAAMATYQRMADMIRLGAYKPGTDREVDEAIA 410 Gluconobacter o...
WP_003599594 339 RGILDGHIVMERRIAEQGRYPAINVLRSVSRTMPRACDPAHLPTVRRARKVLATYADMEELIRLGAYRAGSSPEVDEAVA 418 Methylobacteriu...
WP_002660657 326 KAVLDGHIILDRDLFDRGIYPSINVLSSTSRSIHRIMSLEKQKLIMKARNLLSIYKDYEDLIRTGIYLKGSNKDVDFAIS 405 Lyme disease sp...
WP_011471555 330 RSTLDGHIVLDREVADQGRYPAINVLASVSRLAQHVWSPEERNLVRKLRAMIARFEDTRDLRLMGGYQPGRDNELDQAVQ 409 Rhodopseudomona...
WP_006015095 336 RGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMVARFEETRDLRAIGAYQKGHDGLLDQAVD 415 Brucella ovis
WP_012752121 332 RGTLDGHVVLDRAIAEQGRYPAIELLGSISRLAGEVWTGDQRELVRKLKSMMARFEETRDLRLMGGYRAGSDPDLDQAVS 411 Methylobacteriu...
WP_010920876 411 LNPAIEAFLSQDKEEATSLDDSFGMLGQIL 440 Caulobacter vibrioides
WP_011511753 418 LNPLLEDFLRQAKDEVTSIEDGYRRLQQIL 447 Nitrobacter hamburgensis
WP_011383071 409 YYPAIEAFLGQLKTEATTLQTCYAQLAEVL 438 Magnetospirillum magneticum
WP_011388284 410 YHPALDAFLTQAKTEGTDLATGYAMLEAAL 439 Rhodospirillum rubrum
WP_011253216 411 LMPKLNEFLSQGRNERTTRAEAFEQLAQIM 440 Gluconobacter oxydans
WP_003599594 419 LMPDLTAFLGQGKEEATSISEGYDRLAAIV 448 Methylobacterium extorquens
WP_002660657 406 KYPKIINFISQGINETFDFENLEDEIKEIL 435 Lyme disease spirochete
WP_011471555 410 LVPKIYEVMQQAPSDPAC-GEPFQELLAVI 438 Rhodopseudomonas palustris
WP_006015095 416 FVPRIYEALQQSPETGLS-DDPYNDLAAAL 444 Brucella ovis
WP_012752121 412 LVPRIYEALRQEPGQPPSR-DAFLELAQSL 440 Methylobacterium extorquens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap