Conserved Protein Domain Family

TIGR03498: FliI_clade3 
flagellar protein export ATPase FliI
Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
PSSM-Id: 163293
Aligned: 15 rows
Threshold Bit Score: 643.201
Threshold Setting Gi: 499184310
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_010920876 411 LNPAIEAFLSQDKEEATSLDDSFGMLGQIL 440 Caulobacter vibrioides
WP_011511753 418 LNPLLEDFLRQAKDEVTSIEDGYRRLQQIL 447 Nitrobacter hamburgensis
WP_011383071 409 YYPAIEAFLGQLKTEATTLQTCYAQLAEVL 438 Magnetospirillum magneticum
WP_011388284 410 YHPALDAFLTQAKTEGTDLATGYAMLEAAL 439 Rhodospirillum rubrum
WP_011253216 411 LMPKLNEFLSQGRNERTTRAEAFEQLAQIM 440 Gluconobacter oxydans
WP_003599594 419 LMPDLTAFLGQGKEEATSISEGYDRLAAIV 448 Methylobacterium extorquens
WP_002660657 406 KYPKIINFISQGINETFDFENLEDEIKEIL 435 Lyme disease spirochete
WP_011471555 410 LVPKIYEVMQQAPSDPAC-GEPFQELLAVI 438 Rhodopseudomonas palustris
WP_006015095 416 FVPRIYEALQQSPETGLS-DDPYNDLAAAL 444 Brucella ovis
WP_012752121 412 LVPRIYEALRQEPGQPPSR-DAFLELAQSL 440 Methylobacterium extorquens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap