2FN0,3LOG


Conserved Protein Domain Family
salicyl_syn

?
TIGR03494: salicyl_syn 
Click on image for an interactive view with Cn3D
salicylate synthase
Members of this protein family are salicylate synthases, bifunctional enzymes that make salicylate, in two steps, from chorismate. Members are homologous to anthranilate synthase component I from Trp biosynthesis. Members typically are found in gene regions associated with siderophore or other secondary metabolite biosynthesis.
Statistics
?
PSSM-Id: 132533
View PSSM: TIGR03494
Aligned: 8 rows
Threshold Bit Score: 679.193
Threshold Setting Gi: 81706979
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FN0_A        18 QWLPTISGVLRQFA-EEECYVYERPPCWYLGKGCQARLHINADGTQATF-IDDAGEQKWAv-DSIADCARRFMAHPQVKG 94  Yersinia entero...
BAE59611      16 DALQRVATVLSKLK-SDDYYAYERTGVWYLGIGNRSSVTIDPEGRKATFsTNGKDEVRSId-GGVTDVVREYTSANEDCG 93  Aspergillus ory...
CAJ76921      32 CDPQTLATALSGAEfCHDYVVYEHNGEWAIGINKLQQLTVDTQGRITDF-TGKVDQPNP---KDLCDAIHQATQALPWDG 107 causative agent...
CAJ87585      15 QWLPTISGVLRQFA-EEECYVYERQPCWYLGKGCQARLHINADGTQATF-IDDAGEQKWAv-DSIADCARRFMAHPQVKG 91  Escherichia coli
Q73XV3        28 DLAAELAVVLSERA-GEEYLLYERGGEWVLATGVRAMIELDSDELRVIR-DGVTQRQHWS--GRPGPVLGEAIDRLLLET 103 Mycobacterium a...
Q7D785        28 DLAAELAAVVTESV-DEDYLLYECDGQWVLAAGVQAMVELDSDELRVIR-DGVTRRQQWS--GRPGAALGEAVDRLLLET 103 Mycobacterium t...
XP_001273748  15 DTLNVVTAVLAKHE-ANDYYAYEREEHWYVGLGAESSLLVDSQGKTVTVtTGSTERPRALddSSISDIAREFVDASLEFG 93  Aspergillus cla...
3LOG_A        30 DLAAELAAVVTESV-DEDYLLYECDGQWVLAAGVQAMVELDSDELRVIR-DGVTRRQQWS--GRPGAALGEAVDRLLLET 105 Mycobacterium t...
2FN0_A        95 RRVYGQVGFNFAAHARGIAFNAGEW-PLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEASTtt----qNAPL-- 167 Yersinia entero...
BAE59611      94 TRIYGYIGFSYALLLRGIPHTAGEW-PMLSLMVPRTEVVFYPDRITLTGVDKGETVELSALVDDTTC-------IEPSpg 165 Aspergillus ory...
CAJ76921     108 WRVFGRVDFEFSHFAHQLSHKMTHR-NLLELFIAQHDIRVTHDQVVIRTVAPSFLPHIERVIAEVTTplpvaepIAPLtq 186 causative agent...
CAJ87585      92 RRVYGQVGFNFAAHARGIAFNAGEW-PLLTLTVPREELIFEKGNVTVYADSADGCRRLCEWVKEAGTtt----qNAPL-- 164 Escherichia coli
Q73XV3       104 DQLFGWIAFEFGVYRYGLQQRLAPGtALARVFWPNGRIVVTREAIQLFGTSTGRRDDVLGVLGDG---------VPGLrd 174 Mycobacterium a...
Q7D785       104 DQAFGWVAFEFGVHRYGLQQRLAPHtPLARVFSPRTRIMVSEKEIRLFDAGIRHREAIDRLLATG---------VREVpq 174 Mycobacterium t...
XP_001273748  94 SRIYGQVGFNYAAHIRGQTFNRGQW-PLLSLMVPRTEIVFHEDSVTVTGLHEEEVRSLYEFIKHDAArv----nIESLen 168 Aspergillus cla...
3LOG_A       106 DQAFGWVAFEFGVHRYGLQQRLAPHtPLARVFSPRTRIMVSEKEIRLFDAGIRHREAIDRLLATG---------VREVpq 176 Mycobacterium t...
2FN0_A       168 --AVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPELV 245 Yersinia entero...
BAE59611     166 -hPIDTNTRASEYVEQVEAALADIRAEKYTKVIPSRAVSLPWRVDMPGTLLCGRQHNNPARSFCLRHGNNQAIGFSPELV 244 Aspergillus ory...
CAJ76921     187 adILNHEQIQHDYQAMVAAAVKEIVADDYKKVILSRRATLPAAIDIRRSFISGRGKNTPARSFLLKLGELEAFGFSPETV 266 causative agent...
CAJ87585     165 --VVDTALNGEAYKQQVARAVAEIRRGEYVKVIVSRAIPLPSRIDMPATLLYGRQANTPVRSFMFRQEGREALGFSPELV 242 Escherichia coli
Q73XV3       175 asAVDVVTDPSNYRDRVASAVAEIAAGRYHKVILSRCLQVPFAVDFPSTYRLARRHNTPVRSFLLRLGGIRAVGYSPELV 254 Mycobacterium a...
Q7D785       175 srSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPELV 254 Mycobacterium t...
XP_001273748 169 liDVDTQTDTDSYIARVQRAQTEIAQGLYTKVISSRAVGFTDKVDFPATLLHGRRGNTPARTFCLSHGDKKATGFSPELV 248 Aspergillus cla...
3LOG_A       177 srSVDVSDDPSGFRRRVAVAVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPELV 256 Mycobacterium t...
2FN0_A       246 MSVT-GNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCLPGSVVVEDLMSVRQRGSVQH 324 Yersinia entero...
BAE59611     245 MSLR-DGKVTTEPLAGTRSQEEGGDKSKKLKEALVSDPKEIVEHVLSVKEAINELDRLCSPGTVVVDDLMTVRPRGSVQH 323 Aspergillus ory...
CAJ76921     267 LEVDnLGHLSTQPLAGTRFLPADPIEAERLKKELTTDPKEIAEHATSVKLAIEELEQVCEQETVNVAQFMEVSERGSVQH 346 causative agent...
CAJ87585     243 MSVT-GNKVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQH 321 Escherichia coli
Q73XV3       255 AAVRhDGVVVTEPLAGTRAFGRGALHDRQARDDLESNSKEIVEHAISVRSSLQEMAEIAEPGTAVVTDFMTVRERGSVQH 334 Mycobacterium a...
Q7D785       255 TAVRaDGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQH 334 Mycobacterium t...
XP_001273748 249 LSVK-NGKVTTEPLAGTRSRQGTEKEIAQLRQELLNDPKEIVEHVISVREAVQELKQLCAPDTVIVEDLMSVRERGSVQH 327 Aspergillus cla...
3LOG_A       257 TAVRaDGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQH 336 Mycobacterium t...
2FN0_A       325 LGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLD-DTRFDAALVLRSVFQDSQRC 403 Yersinia entero...
BAE59611     324 LGSTVSGALLPGKDAWDAFNILFPSITATGIPKQAALEGIGRLEKHPRELYSGAILLIEdPETWDVALVLRTVFQGREKQ 403 Aspergillus ory...
CAJ76921     347 LASRVTGQLAQDKSAWNAFKVLFPAITASGIPKREAIEAITRYEPTSRGLYSGSVLIADqDGFFDAALVLRAAYKRHSLS 426 causative agent...
CAJ87585     322 LGSGVSGQLAENKDAWDAFTVLFPSITASGIPKNAALNAIMQIEKTPRELYSGAILLLD-DTRFDAALVLRSVFQDSQRC 400 Escherichia coli
Q73XV3       335 LGSTVSGRLGTSNDRMDALEALFPAVTASGIPKAGGVEAILRLDEGPRGLYSGAVVMVSaDGALDAALTLRAAYEHDGKT 414 Mycobacterium a...
Q7D785       335 LGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSaDGGLDAALTLRAAYQVGGRT 414 Mycobacterium t...
XP_001273748 328 LGSRVAGMLASDKDIWHAFDTLFPSITASGIPKDAAIEAIQRLENQPRELYSGAVLLIEgSETLEAALVLRTVYQCSEKQ 407 Aspergillus cla...
3LOG_A       337 LGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSaDGGLDAALTLRAAYQVGGRT 416 Mycobacterium t...
2FN0_A       404 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 437 Yersinia enterocolitica
BAE59611     404 RIQAGAGIVAQSSPGRELTETSEKLASIAPYVIA 437 Aspergillus oryzae RIB40
CAJ76921     427 MLQAGAGIISLSTPDREWQETCEKMACVLDHLIF 460 causative agent of fish pasteurellosis
CAJ87585     401 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 434 Escherichia coli
Q73XV3       415 WLRAGAGIIEESTPEREFEETCEKLSTLAPYLIA 448 Mycobacterium avium subsp. paratuberculosis K-10
Q7D785       415 WLRAGAGIIEESEPEREFEETCEKLSTLTPYLVA 448 Mycobacterium tuberculosis
XP_001273748 408 WIQAGAGILAQSSPQRELIETQEKLASIAPFIMA 441 Aspergillus clavatus NRRL 1
3LOG_A       417 WLRAGAGIIEESEPEREFEETCEKLSTLTPYLVA 450 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap