Conserved Protein Domain Family

TIGR03494: salicyl_syn 
Click on image for an interactive view with Cn3D
salicylate synthase
Members of this protein family are salicylate synthases, bifunctional enzymes that make salicylate, in two steps, from chorismate. Members are homologous to anthranilate synthase component I from Trp biosynthesis. Members typically are found in gene regions associated with siderophore or other secondary metabolite biosynthesis.
PSSM-Id: 132533
Aligned: 8 rows
Threshold Bit Score: 679.193
Threshold Setting Gi: 81706979
Created: 9-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
2FN0_A       404 WIQAGAGIIAQSTPERELTETREKLASIAPYLMV 437 Yersinia enterocolitica
CAJ76921     427 MLQAGAGIISLSTPDREWQETCEKMACVLDHLIF 460 causative agent of fish pasteurellosis
Q73XV3       415 WLRAGAGIIEESTPEREFEETCEKLSTLAPYLIA 448 Mycobacterium avium subsp. paratuberculosis K-10
Q7D785       415 WLRAGAGIIEESEPEREFEETCEKLSTLTPYLVA 448 Mycobacterium tuberculosis
XP_001273748 408 WIQAGAGILAQSSPQRELIETQEKLASIAPFIMA 441 Aspergillus clavatus NRRL 1
3LOG_A       417 WLRAGAGIIEESEPEREFEETCEKLSTLTPYLVA 450 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap