Conserved Protein Domain Family
cas_csp1

?
TIGR03489: cas_csp1 
CRISPR-associated protein Cas7/Csp1, subtype PGING
Members of this protein family are Csp1, a CRISPR-associated (cas) gene marker for the Pging subtype of CRISPR/cas system, as found in Porphyromonas gingivalis W83 and Bacteroides forsythus ATCC 43037. This protein belongs to the family of DevR (TIGR01875), a regulator of development in Myxococcus xanthus located in a cas gene region. A different branch of the DevR family, Cst2 (TIGR02585), is a marker for the Tneap subtype of CRISPR/cas system.
Statistics
?
PSSM-Id: 132528
View PSSM: TIGR03489
Aligned: 2 rows
Threshold Bit Score: 585.841
Threshold Setting Gi: 503991631
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005874854  14 VAPFENHMANGGEKLFGNASSIKRRPDGRVYVSGQMQRHVLFSAIDRLNHLDKAKGTTFVSNGDGITNLIEIDLRADLGG 93  Porphyromonas g...
WP_014225625  11 LAPFENHIANGGEKLLGNASSIKRRPDGRVYVSGQMQRHVLFSAIDRLNLADPNHGDTFVSNGDGVSNQIERDLRADMGG 90  Tannerella fors...
WP_005874854  94 FMHTNKGDYSDRRIAPLSVTPATALDTSSVGRDLLVRIRFDKSSDAKNQALATREYSEQDKMNMNFFLDITSVGVSKSFV 173 Porphyromonas g...
WP_014225625  91 FMHPSKGDYSGRRTAPLSVTPAVAMKESEIGRDLLVRLKMDTTESSQDQALATKEFSEYDLMHMNFFLDVSALSISKAFT 170 Tannerella fors...
WP_005874854 174 YKDGLNLGTKYFKHITDDEKKRRVKLFLEATRIMNDYANQARNAVCGEPEKVLIVFDDRLSRKACRYYTVGEKEQANIIK 253 Porphyromonas g...
WP_014225625 171 YEGGFNLGTQYFKHANEEERKRRARLYLEATKSMNDYANQARNAVSGEPQQVLIVFDTVLSRKASRFYTADEQEKKNILA 250 Tannerella fors...
WP_005874854 254 ELDQYQVKYFVGDDASDYSVADAYRDAMNYLDKATLVDFAEGEEIMTFAEAF 305 Porphyromonas gingivalis
WP_014225625 251 ELKERGATCFIGDDNSEKSVAKAYQEALAFLEKNTLFDPSSNAEVKTFQEVF 302 Tannerella forsythia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap