Conserved Protein Domain Family
cas_Cas5p

?
TIGR03488: cas_Cas5p 
CRISPR-associated protein Cas5, subtype PGING
CC Members of this protein family are cas, or CRISPR-associated, proteins. The two sequences in the alignment seed are found within cas gene clusters that are adjacent to CRISPR DNA repeats in two members of the order Bacteroidales, Porphyromonas gingivalis W83 and Bacteroides forsythus ATCC 43037. This cas protein family is unique to the Pgingi (Porphyromonas gingivalis) subtype, but shows some sequence similarity to genes of the Cas5 type (see TIGR02593).
Statistics
?
PSSM-Id: 132527
View PSSM: TIGR03488
Aligned: 2 rows
Threshold Bit Score: 445.565
Threshold Setting Gi: 503991629
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005874864   4 IDLSILGKDPDLSASIKLHIEPHAPISMVSELPGSYYKALLYPDKHILCGLFENVLGWHFSRKDREIITKEIKNIRKKTK 83  Porphyromonas g...
WP_014225623   6 IDLAVLQKIPHKIVKTKLVVEPLAPLSMVSEMPGSFYKTLNVPSKKMICGLIENVLGWHIDWKDRRAIQKDIEKLRKKQK 85  Tannerella fors...
WP_005874864  84 KGYIPPTIRSIFIPLLSDFFELDSVRIVSTDSPFFYNDLWKRAFRRKDAgKIHFGGTQNIDYTLVMDKFRFmcenERTLE 163 Porphyromonas g...
WP_014225623  86 VTHSSNTKGSTYIPLLMEYFDVIDQPTIDFSEVCFFNDLWKRCYRRADA-VVHPNGTENMDYRYISNKWKL----KRDEK 160 Tannerella fors...
WP_005874864 164 TEEKTDQKE-EKFLRENIDRISFFYTTPTNREYLFFEGNYECVIKMDPQLVDLLSKTLPQQNMGYLGNSEGWVTLYL 239 Porphyromonas ging...
WP_014225623 161 NRDKIDNHAlEVFFKENIDFFPMYYATPTVREYIHLHGRYIIPMLMDERLFVMLYDILDTNNIGYLGNNEGWVNLKL 237 Tannerella forsythia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap