Conserved Protein Domain Family
cas_csp2

?
TIGR03487: cas_csp2 
CRISPR-associated protein Cas8c/Csp2, subtype PGING
Members of this protein family are cas, or CRISPR-associated, proteins. The two sequences in the alignment seed are found within cas gene clusters that are adjacent to CRISPR DNA repeats in two members of the order Bacteroidales, Porphyromonas gingivalis W83 and Bacteroides forsythus ATCC 43037. This cas protein family is unique to the Pging (Porphyromonas gingivalis) subtype.
Statistics
?
PSSM-Id: 132526
View PSSM: TIGR03487
Aligned: 2 rows
Threshold Bit Score: 873.938
Threshold Setting Gi: 492527042
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014225624   4 HPYIRYAQALLMVENNLSSINEITLEHIKNEIEKGLNSFRVRPSGSIAGKSKVQYVFDRIEKGDTKKGVFLSPNTISSDK 83  Tannerella fors...
WP_005874855   5 HYYIRYGCAITLYDNHVSERERLTPKELRFSIEKAVSSFRIQAQEPFSPGSKARFSFVKRKDGNTKNGIFLSPHIVTKDM 84  Porphyromonas g...
WP_014225624  84 QARNLWGAAAKFLQ----GMDNDKcDDLSKNTEIGMSEVPISGEFLSFSDKgNIGRGKPKSSIKEQGFGIISTLTPLKPC 159 Tannerella fors...
WP_005874855  85 HAQKVWTKASKFLEidylGKDNER-EGLLKKDNVSMSNIPISGEYLTFGEK-DTGRGSAKISVEEQTYGLITTLTPLKPA 162 Porphyromonas g...
WP_014225624 160 FQykIGKKgqpemfNVCIIPDLPIVEMVNFIRVFKQMRIQKLNGDLLTGDVvtqtDKQGkikdiSPKRPLIYNGNFPNPP 239 Tannerella fors...
WP_005874855 163 LQ--VGKD------NFCIIPDIPLNQMVDFIALFDKMQITHLSGEAMLGNI----DNKG-----IPHRPKIFRGNFPNSP 225 Porphyromonas g...
WP_014225624 240 KSSALGSVSLLGAIGEFAKQAEVSDRALGVLESLKKATMYMVKYGNATTFTYNHYIVDMAKKAKLRTVIDSLYYSKLFNQ 319 Tannerella fors...
WP_005874855 226 KSDRMGAIALLGAIGEFAKHAEFSTLAQKVLDSLKGSTLYLITYGNAIPFTFHHYIIDLAKEGKLHSIVDSLFYSRLYKK 305 Porphyromonas g...
WP_014225624 320 DRRSSINTEYQKFDLFTSRFLQLFTQPAFKDFLSFRAEYPEQVQLLLNIYFVKMERIDAEIVTSARQLGKWLNLVAYFAA 399 Tannerella fors...
WP_005874855 306 EKRVYGDTDYDRFDFFTNRFLQSFNKAAFDDFFSSRVEYPNQIKILFQMFFTKMEKLKTDVIASAQILGSWLNQVAYFAA 385 Porphyromonas g...
WP_014225624 400 KSEV--REGANNYWEEirkvKSKVLVELESSTFAAKSGDALVAQVITRAGRLSGMDAPESASLFMEKTMSGDLPLDCAKN 477 Tannerella fors...
WP_005874855 386 KEEAdsRISPGNIFEE----KAKFLVMMESSIYAAKRGDALIAQILILAGRLSKNEAPKEALLFMEKTITGEIDLSVAKN 461 Porphyromonas g...
WP_014225624 478 LLIAFSRLR 486 Tannerella forsythia
WP_005874855 462 LLIAYMRIR 470 Porphyromonas gingivalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap