Conserved Protein Domain Family
cas_csx13_N

?
TIGR03485: cas_csx13_N 
CRISPR-associated protein Cas8a1/Csx13, MYXAN subtype
Members of this family are found among cas (CRISPR-Associated) genes close to CRISPR repeats in Leptospira interrogans (a spirochete), Myxococcus xanthus (a delta-proteobacterium), and Lyngbya sp. PCC 8106 (a cyanobacterium). It is found with other cas genes in Anabaena variabilis ATCC 29413. In Lyngbya sp., the protein is split into two tandem genes. This model corresponds to the N-terminal region or upstream gene; the C-terminal region is described by TIGR03486. CRISPR/cas systems are associated with prokaryotic acquired resistance to phage and other exogenous DNA.
Statistics
?
PSSM-Id: 132524
View PSSM: TIGR03485
Aligned: 4 rows
Threshold Bit Score: 416.928
Threshold Setting Gi: 521967524
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EAW36791             10 LHFNLSEPNFTILHCLGLAGLAMSLKQIEKQYPLPAQRP-----GKLNWCVDSRNIDLYWQGQD-SLALDWLFKESFKID 83  Lyngbya ...
jgi:Ava_3491         10 IQLNLGDPSMTLLHRAGVAGLWMTLKKLEKIYPTPAERI-----GNLTWLLTPHYINLDWEGQD-FTVLDWLLKQSFQIS 83  Anabaena...
chgcsh:AE010300_704  18 VFQRGLSECTSPLLRAGLAGLYSTLYSLKDEKKP----------KTLSWELTQDSIQITSKGEF-SKDFQWIINHGYQTK 86  Leptospi...
WP_020479129         16 LSIRLYAPGMTPLLRAGAGGLAASLRAILGSASPAAPWPspvrlGPGTATVEQEAIHLDWGGKApEATLRALFGASFRVK 95  Myxococc...
EAW36791             84 qRGLISFTGLNPESMPLPT---QIVNHQCLTnSSFLQHNKFFKSGGVASESITVDEIPIEVKY-----KRAVSYAHQNFA 155 Lyngbya ...
jgi:Ava_3491         84 dEGLISLTGLDSQNMDIQN---QIIIHQGIT-ATFTQHNKFFKSAGQQSKQLIIDGIQVRVDY-----KKAASYAHQHFA 154 Anabaena...
chgcsh:AE010300_704  87 -EGIFYCPGIHRTKTIHKD---RMHFHNAMM-GTFLQHGRIQVRTKGAGTAVSIEDECKLLYFpllveEKKIKYRKDAES 161 Leptospi...
WP_020479129         96 -QGFIDLPGTRPPGAPEPPpelAAALHDALK-VTFLQHGKSTQGGARRRVTFEVDARPVIVES-----QGYDSFVHQTAW 168 Myxococc...
EAW36791            156 PKICDPQG--NLYQEPIQIVSWLYPGAIVRHAAAEKSTKIEETVEQAIALLYAPVACIYYLVRsrihNQKAQYAVVIPVI 233 Lyngbya ...
jgi:Ava_3491        155 KHLCDQYG--QLLKEPIGIRGWLYPGAVVRHYAFKEQTAFEEKAEYALALLFAPMACQYFVLRshtePSHTNYVLVIPEV 232 Anabaena...
chgcsh:AE010300_704 162 ILFAEKRGstWSFENLVELSGYVMPGAPPR---FTHETSWIGTIADAFLLFFAPLSCSFAEIE----PSRGTWCILIPEL 234 Leptospi...
WP_020479129        169 QSVLEA-----LEVGSTSLASWAYPGAAERHIGVR-VTKVEYTAAEALCACFALVGCVSYKLP-----QLRGGAFVALAP 237 Myxococc...
EAW36791            234 TNLESYALQRLELNHLSYQELYVTGTGDAGLKSLYYLATSQTTDp--NKIQKCKVIVYGTFTWSKQQKVR-GDVKLIKST 310 Lyngbya ...
jgi:Ava_3491        233 IDLELYAHFLWCLGNLDYKHFHVSSLGDAGLKFLNYKTTQMPTS---NFLKRCQIIFFSTKAWSEQQKTR-AEIAIIELN 308 Anabaena...
chgcsh:AE010300_704 235 EDLETFERFRRDY-EVNTINMFAGGPGDAALRYLTEMDLTGNKKd--FSPNGCEVYVIGKVAWNKKQQVR-RLMMRIHPT 310 Leptospi...
WP_020479129        238 TNLVRFAELRPGLTPKRLRDVAVAGASDAVLAAQLVMAQEAGKKrlgAVLGTTEAVALRQMPWNAQQKIRgAVVRQDAVL 317 Myxococc...
EAW36791            311 VAVNHHYQLIHHLFPN-RAVK 330 Lyngbya sp. PCC 8106
jgi:Ava_3491        309 SSVNYLYKLSCICFPEcQIVL 329 Anabaena variabilis ATCC 29413
chgcsh:AE010300_704 311 EKNFRIYKKMRGIFQNkIHLK 331 Leptospira interrogans serovar Lai str. 56601
WP_020479129        318 EEVLDRYEAAAAALPHtLRVR 338 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap