2IVF


Conserved Protein Domain Family
DMSO_red_II_alp

?
TIGR03479: DMSO_red_II_alp 
Click on image for an interactive view with Cn3D
DMSO reductase family type II enzyme, molybdopterin subunit
This model represents the molybdopterin subunit, typically called the alpha subunit, of various proteins that also contain an iron-sulfur subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase, ethylbenzene dehydrogenase, and an archaeal respiratory nitrate reductase. This alpha subunit has a twin-arginine translocation (TAT) signal for Sec-independent translocation across the plasma membrane.
Statistics
?
PSSM-Id: 132519
View PSSM: TIGR03479
Aligned: 6 rows
Threshold Bit Score: 1420.34
Threshold Setting Gi: 14994027
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IVF_A    21 RRDFLKRSG-AAVLSLSLSSl--aTGVVPGFLKDAQAGT-KAPGYASWEDIYRKEWKWDKVNWGSHLNICwpQGSCKFYV 96   Aromatoleum aromat...
Q9S1H0    14 RRRFLQFSM-AALASAAAPS----SVWAFSKIQPIEDPL-KSYPYRDWEDLYRKEWTWDSTGFITHSNGC--VAGCAWRV 85   Thauera selenatis
Q8GPG4     6 RRTLMQG---ASLVGAGLFAa--gRGWALNRLEPIGDTLaEEYPYRDWEDLYRNEFTWDYVGKAAHCINC--LGNCAFDI 78   Rhodovulum sulfido...
AAO49008   6 RRDFLKASA-ATLLG---------NSLTFKTLAATMDLS-GAFEYSGWENFHRNQWSWDKKTRGAHLINC--TGACPHFV 72   Dechloromonas agitata
AAK76387  21 RRDFLKRSG-AAVLSLSLSSl--aTGVVPGFLKDAQAGT-KAPGYASWEDIYRKEWKWDKVNWGSHLNICwpQGSCKFYV 96   Azoarcus sp. EB1
CAF21906  46 RRTFLEGIGvASLLGIGTSAasddSLFQMGGLKPVDDPI-GNYPYRDWEDLYREKWDWDSVSRSTHSVNC--TGSCSWNV 122  Haloferax mediterr...
2IVF_A    97 YVRNGIVWREEQAAQTPACnVDYVDYNPLGCQKGSAFNNNLYGDERVKYPLKRVGKRGEGKWKRVSWDEAAGDIADSIID 176  Aromatoleum aromat...
Q9S1H0    86 FVKNGVPMREEQVSEYPQL-PGVPDMNPRGCQKGAVYCSWSKQPDFLKYPLKRVGERGERKWKRISWDEAFTEIADKIID 164  Thauera selenatis
Q8GPG4    79 YVKDGIVIREEQLAKYPQIsPDIPDANPRGCQKGAIHSTSMYEADRLRYPMKRVGARGEGKWQRISWDQATEEIADKIID 158  Rhodovulum sulfido...
AAO49008  73 YTKDGVVIREEQSKDIPPM-PNIPELNPRGCNKGECAHHYMYGPHRLKYPLIRVGERGEGKWRRATWEEALDLISDKIID 151  Dechloromonas agitata
AAK76387  97 YVRNGIVWREEQAAQTPACnVDYVDYNPLGCQKGSAFNNNLYGDERVKYPLKRVGKRGEGKWKRVSWDEAAGDIADSIID 176  Azoarcus sp. EB1
CAF21906 123 YVKNGQVWREEQSGDYPRFdESLPDPNPRGCQKGACYTDYVNADQRIKHPLKRVGERGEGKWKRISWDEALTEIAEHVVD 202  Haloferax mediterr...
2IVF_A   177 SFEAQGSDGFILdaPHVHAGSIAWGAGFRMTYLMDGVSPDINVDIGDTYMGAFHTFGKMHMGYSADNLLDAELIFMTCSN 256  Aromatoleum aromat...
Q9S1H0   165 TTVKRGPGNVCM--PKRPFAVITSAGYSRLANLIGAIKPDVSSMTGDLYPGIQTVRMPARTVSTFDDWFTSDLILMWHKN 242  Thauera selenatis
Q8GPG4   159 IYEKYGPGKLMThtGSGNMSMMRMAAPYRFASLVGGVQLDIFTDVGDLNTGAHLAYGNALESFTSDAWFGADYIMFLLFN 238  Rhodovulum sulfido...
AAO49008 152 TIKNHSPDCISVysPLPGTAPVSFSAGHRFAHYIGAHTHTFFDWYSDHPTGQTQTCGVQGDSAECSDWFNSKYIILWGAN 231  Dechloromonas agitata
AAK76387 177 SFEAQGSDGFILdaPHVHAGSIAWGAGFRMTYLMDGVSPDINVDIGDTYMGAFHTFGKMHMGYSADNLLDAELIFMTCSN 256  Azoarcus sp. EB1
CAF21906 203 EVEAGRYDAISGftPIPAMSPVSFASGSRLVNLLGGVSHSFYDWYSDLPPGQPITWGTQTDNAESADWYNADYIIAWGVE 282  Haloferax mediterr...
2IVF_A   257 WSYTYPSSYHFLSEARYKGAEVVVIAPDFNPTTPAADLHVPVRVGSDAAFWLGLSQVMIDEKLFDRQFVCEQTDLPLLVR 336  Aromatoleum aromat...
Q9S1H0   243 PIVTRIPDAHFLTEARYNGARLVNISPDYNPSSVHADLHLPVTTGTDSHLAAAIVNVLIADKKYKADYLKEQTDLPFLVR 322  Thauera selenatis
Q8GPG4   239 PVATRIPDAHFLWEAKWNGARVVSVAPDYNPSSIHSDLWMPIKQGADPFLAMSMVNVIIEGKLYNEAFMKEQTDLPILVR 318  Rhodovulum sulfido...
AAO49008 232 PTQTRIPDAHFLSEAQLNGAKVVSISPDFNSSTIKADRWIHPLPGTDGALALAMAHVIIKEKLYDAHNLKEQTDLPYLIR 311  Dechloromonas agitata
AAK76387 257 WSYTYPSSYHFLSEARYKGAEVVVIAPDFNPTTPAADLHVPVRVGSDAAFWLGLSQVMIDEKLFDRQFVCEQTDLPLLVR 336  Azoarcus sp. EB1
CAF21906 283 INVTRIPDAKYFLESGYNGTKRVGVFTDYSQTAIHTDEWLSPDSGTDTALALGMAQTIVDEGLYDEAHLKEQTDMPLLVR 362  Haloferax mediterr...
2IVF_A   337 MDTGKFLSAEDV------DGGEAKQFYFFDEKaGSVRKASR------GT-------------------LKLD-FMPALEG 384  Aromatoleum aromat...
Q9S1H0   323 TDNGKFLREKDFn-----KDGSDEVFYIWDSKsGKAVLAPGsmgskdKT-------------------LKLGaVEPALEG 378  Thauera selenatis
Q8GPG4   319 SDNGMLLREADLe-----EGGSDQVFYHWDSRtGAAVKVKGsmgseeKT-------------------LVLGdVDPALEG 374  Rhodovulum sulfido...
AAO49008 312 RDTKRFLREADVv-----AGGSKDKFYIWDSKtGKPVITKGswgdqpEQkappvafmgrnthtfpkgyIALEnLDPALEG 386  Dechloromonas agitata
AAK76387 337 MDTGKFLSAEDV------DGGEAKQFYFFDEKaGSVRKASRa-------------------------tLKLD-FMPALEG 384  Azoarcus sp. EB1
CAF21906 363 QDTGKFLRASDVpsvntdADRPEWMLLMLDSN-GRIREAPGslgerdGQkdy-------------sksIELD-FDPQLDG 427  Haloferax mediterr...
2IVF_A   385 tfSArlkngKTIQVRTVFEGLREHL-KDYTPEKASAKCGVPVSLIRELGRKVAKKRTCSYI-GFSSAKSYHGDLMERSLF 462  Aromatoleum aromat...
Q9S1H0   379 tfDA-----NGIEVTTVFARLKAEI-APYTPEATHKTTGIHPSVVRQLAGWIGDCKALRILdGYNNQKHFDGFQCGRLKI 452  Thauera selenatis
Q8GPG4   375 sfEV-----GGIPVTTVFEKVRAEA-AKYPPEETAAITGIGPGVVRAEAETFARAKKALLMtGFNIGRYSNGIYTSWALT 448  Rhodovulum sulfido...
AAO49008 387 kfQVklqdgNTVEVRPVFEILKSRIeADNNIAKAAKITGVPAKTIIEVAREYATTQPAMIIcGGGTMHWYYSDVLLRAMH 466  Dechloromonas agitata
AAK76387 385 tfSArlkngKTIQVRTVFEGLREHL-KDYTPEKASAKCGVPVSLIRELGRKVAKKRTCSYI-GFSSAKSYHGDLMERSLF 462  Azoarcus sp. EB1
CAF21906 428 --EQrsnpsGRVQVRTVWAELRDEL-ANWDPEMVHEETTVGKETYQRIAREFAEADKAKIIqGKGVNDWYHNDLGNRALQ 504  Haloferax mediterr...
2IVF_A   463 LAMALSGNWGKPGTGAFAWAYsddnMVYLGVMSkptaqggmdelhqmaegFNkrTleadptsTDEMGniefmkvvtsavg 542  Aromatoleum aromat...
Q9S1H0   453 LILTLIGHHGTTGSIDTTYEG----WVLEGNKA-----------------LG--GvkgrpgrSVSMV------------- 496  Thauera selenatis
Q8GPG4   449 LMLALTGHGGRTGGLDTSWIA----WNQPALLE-----------------LAffDfkk-lprLEAGG------------- 493  Rhodovulum sulfido...
AAO49008 467 LLTALVGSEGKNGGGMNHYIGqwkpVFLPGVAA-----------------LAfpEg-----pANERS------------- 511  Dechloromonas agitata
AAK76387 463 LAMALSGNWGKPGTGAFAWAYsddnMVYLGVMSkptaqggmdelhqmaegFNkrTleadptsTDEMGniefmkvltsavg 542  Azoarcus sp. EB1
CAF21906 505 LLVTLTGNLGEQGTGLDHYVGqekiWTFHGWKT-----------------LSfpT-------GKVRG------------- 547  Haloferax mediterr...
2IVF_A   543 lVPPAMW--------LYYHVGydqlwNNKAwtdPALKksFGAYLDEAKEKGWWTNdhiRPAPd-----KTPQVYMLLSQN 609  Aromatoleum aromat...
Q9S1H0   497 -LAQWVWgeqyrrskAYFDDT-----ELREqigFGVDe-MEALRKESEANGWMPN---WQSI------KDPVVYINAGIN 560  Thauera selenatis
Q8GPG4   494 -LGEFVRggmmehsrQHYDND-----KLKArtgFDLDe-LQEMIDESIDAGWMPY---Y---------GDMKGLISIADN 554  Rhodovulum sulfido...
AAO49008 512 -CQTTIW--------TYIHAE-----VNDEmanVGID--TDKYLMHAIDTRQMPN---YPRDg-----RDPKVFIVYRGN 567  Dechloromonas agitata
AAK76387 543 lVPPAMW--------LYYHVGydqlwNNKAwtdPALKksFGAYLDEAKEKGWWTN-----DHirpapdKTPQVYMLLSQN 609  Azoarcus sp. EB1
CAF21906 548 -VPTTLW--------TYYHAG-----ILDT---PNPD--TAAKIRESIDKGWMPV---YPEErdngsrPDPTTMFVRRGN 605  Haloferax mediterr...
2IVF_A   610 PMRRKRsGAKMFPDVLFPKL-KMIFALETRMSSSAMYADIVLPCAWYYEKHEMTTpCSGNPFFTFVDRSVAPPGECREEW 688  Aromatoleum aromat...
Q9S1H0   561 TFATST-GYQHLRENFLKRC-ELYVVVDFRLNSGAMYADIVLPAATNLEKLDIRE-TSSTRFIHAFGQPIKPMYDRRTDW 637  Thauera selenatis
Q8GPG4   555 KFRRNK-NAEAYRERILEEVeELFVDINVRMDSTAQWADYLLPAAAHYEAWDLRS-IAFHRFVNVFSRPVPPIGEAKSDW 632  Rhodovulum sulfido...
AAO49008 568 WLNQAK-GQKYVLRNLWPKL-DLIVDINIRMDSTALYSDVVLPSAHWYEKLDLNV-TAEHTYINMTEPAIKPMWESKTDW 644  Dechloromonas agitata
AAK76387 610 PMRRKRsGAKMFPDVLFPKL-KMIFALETRMSSSAMYADIVLPCAWYYEKHEMTTpCSGNPFFTFVDRSVAPPGECREEW 688  Azoarcus sp. EB1
CAF21906 606 YFNQAK-GNVAVEEQLWPKL-DLVVDINFRMDSTAMYSDIVLPTASHYEKHDLSM-TDMHTYVHPFTPAVEPLGESKTDW 682  Haloferax mediterr...
2IVF_A   689 DAIALILKKVGERAAARGLTEFNDHN-GRKRRYDELYKKFTMD------GHLLTNEDCLKEMVDINRAVgv--faKDYTY 759  Aromatoleum aromat...
Q9S1H0   638 QISVGLARKIQERARARGITRVDDPEiKSFIDFDKVYDEFTMN------GAVEKDEDALRFVMEKSKAL------GPGSY 705  Thauera selenatis
Q8GPG4   633 EIMEILTRKIQERAIARGITGYEDGDvTR--DFATIHDDYTMD------GTLMTDHDVVSWLVENGPEF------AGATL 698  Rhodovulum sulfido...
AAO49008 645 QIFLALAKRVEMSAKRKSFERFYDEQfKWARDLTNLWNQMTMD------GKLAEDEAAAQYILDTAPHS------KGITL 712  Dechloromonas agitata
AAK76387 689 DAIALILKKVGERAAARGLTEFNDHN-GRKRRYDELYKKFTMD------GHLLTNEDCLKEMVDINRAVgv--faKDYTY 759  Azoarcus sp. EB1
CAF21906 683 QIFRELAQKILEVATERGVEPISDRRfDREIDLQSVYDDYVRDwetgeeGALAEDRAACEYILEHSEESnpadsdEQITF 762  Haloferax mediterr...
2IVF_A   760 EKFKKEGqtrFLSMGTGvsryaHANEVDVTKPIYPMRWHFDDKKVFPTHTRRAQFYLDHDWYLEAGESLPTHKDTP-MVG 838  Aromatoleum aromat...
Q9S1H0   706 EEVLKRG---FVGVGPSa---gKTGPVPADKPYRPFTVNVSEKVPYKTLTGRLQFYIDHDWYQRFGATVPKPQYGGgVLG 779  Thauera selenatis
Q8GPG4   699 EEGVERG---FFVMGEDa---gPTQKLRPSEPYHAFLQQTEGKEPYKTMTGRITFFVDHPRFVRLGATVPTARHHAgRDA 772  Rhodovulum sulfido...
AAO49008 713 QMLREKGe-rFKAN--------WTSPMKEGVPYTPFQNYIVDKKPWPTLTGRQQFYLDHEVFFEMGVELPTYKAP--VDA 781  Dechloromonas agitata
AAK76387 760 EKFKKEGqtrFLSMGTGasryaHANEVDVTKPIYPMRWHFDDKKVFPTHTRRAQFYLDHDWYLEAGESLPTHKDTP-MVG 838  Azoarcus sp. EB1
CAF21906 763 ADTVEQPq-rLLEAGDH-----WTSDIEDGEAYAPWKDFVQDKNPWPTVTGRQQYYIDHDWFLELGEELPTHKEGSeNTG 836  Haloferax mediterr...
2IVF_A   839 -GDHPFKITGGHPRVSIHSTHLTNSHLSRLHRGQPVVHMNSKDAAELGIKDGDMAKLFNDFADCEIMVRTAPNVQPKQCI 917  Aromatoleum aromat...
Q9S1H0   780 pKKYPFVYNTPHTRWGVHSFARTDQWMLRHQRGEPDVRLNPAAMARKGIKDGDQVRIFNSSGEFFAMAKAWPGLPENMLF 859  Thauera selenatis
Q8GPG4   773 -SNYPLNFFSPHTRWGIHSNWRSNKFMLRLQRGEPNIYISPQLAAAKGIADGAQVRVFNELSFFFAQAKFYPSLPPDTIM 851  Rhodovulum sulfido...
AAO49008 782 -DKFPFRFNSPHSRHSIHSTFKDSVLMLRLQRGGPCVEISPIDATAIGVKDNDWVEIWNSHGKVICRAKIRAGEQRGRVS 860  Dechloromonas agitata
AAK76387 839 -GDHPFKITGGHPRVSIHSTHLTNSHLSRLHRGQPVVHMNSKDAAELGIKDGDMAKLFNDFADCEIMVRTAPNVQPKQCI 917  Azoarcus sp. EB1
CAF21906 837 -GDYPMEYNTPHGRWAIHSTWRDSEKLLRLQRGEPLLYLHPEDAEERGIEDGDSVEVFNDLAEVELQAKIYPSSQRGTAR 915  Haloferax mediterr...
2IVF_A   918 VYF-WDAHQYKGWKPYDILLIGMPKPLHLA----GGYEQFRYYFMNGSPAPVtDRGVRVSIK 974  Aromatoleum aromaticum EbN1
Q9S1H0   860 SEHgWEQYLYKNMTHYNSVNAELINPLELV----GGYGHVKFAAGGFNPNRI-FHETTVDVE 916  Thauera selenatis
Q8GPG4   852 MEHgWEPHQFPNWRPMNVCMATLLQPLELV----GGWGHLNFSLWHWNANQL-AHESSVDIE 908  Rhodovulum sulfidophilum
AAO49008 861 MWHtPELYMDLLEGSTQSVCPVRITPTHLV----GNYGHLVFRPNYYGPAGS-QRDVRVDVK 917  Dechloromonas agitata
AAK76387 918 VYF-WDAHQYKGWKPYDILLIGMPKPLHLA----GGYEQFRYYFMNGSPAPVtDRGVRVSIK 974  Azoarcus sp. EB1
CAF21906 916 MYFaWERFQFDSDSNFNSLVPMYMKPTQLVqypeDSGEHLHFFPNYWGPTGV-NSDVRVDVR 976  Haloferax mediterranei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap