2IVF


Conserved Protein Domain Family
DMSO_red_II_bet

?
TIGR03478: DMSO_red_II_bet 
Click on image for an interactive view with Cn3D
DMSO reductase family type II enzyme, iron-sulfur subunit
This model represents the iron-sulfur subunit, typically called the beta subunit, of various proteins that also contain a molybdopterin subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 132518
View PSSM: TIGR03478
Aligned: 6 rows
Threshold Bit Score: 608.327
Threshold Setting Gi: 63029706
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IVF_B    16 KRQLVTVIDLNKCLGCQTCTVACKNIWTKRPGTEHMRWNNVTTYPGKGYPRDYERKGGGFLR---GEPQPGVLPTLIDSG 92  Aromatoleum aromati...
Q9S1G9     3 QRQLAYVFDLNKCIGCHTCTMACKQLWTNRDGREYMYWNNVESRPGKGYPKNWEQKGGGFDKd-gKLKTNGIIPIRADYG 81  Thauera selenatis
Q8GPG3     3 KRQISMVLDLNKCIGCQTCTSACKLQWTNRNGREYMYWNNVETHPGPGYPRNYEHSGGGFDEe-gALKI-GITPSAEDYG 80  Rhodovulum sulfidop...
AAK76388  16 KRQLVTVIDLNKCLGCQTCTVACKNIWTKRPGTEHMRWNNVTTYPGKGYPRDYERKGGGFLRg---ePQPGVLPTLIDSG 92  Azoarcus sp. EB1
AAY27748   9 KRQLAYVADLNKCIGCQTCTVACKTLWTSGPGQDYMYWRNVETAPGLGYPRNWQSKGGGYKd--gVLQK-GKIPPMIDYG 85  Dechloromonas agitata
CAD22070  23 DHQVAMVMDLNKCIGCQTCTIACKNLWTEDGGSEYMYWNNVETKPGEGYPRGWENSGGGWKSgehKERQPGEIPDEEDYG 102 Haloarcula marismortui
2IVF_B    93 DDFQFNHKEVFYEGKGQTVHFHPTskstgkdPAWGYNWDEDQGGGKWPNPFFFYLARMCNHCTNPACLAACPTGAIYKRE 172 Aromatoleum aromati...
Q9S1G9    82 GTWNYNLLETLVEGKSNQVVPDEK-------PTWGPNWDEDEGKGEFPNNHYFYLPRICNHCSNPACLAACPTKAIYKRE 154 Thauera selenatis
Q8GPG3    81 IPWEYNYEEALMTGTDPWLRPNVK-------PTWGANWNEDEGRGEYPNSYYFYLPRICNHCANPGCLAACARNAIYKRQ 153 Rhodovulum sulfidop...
AAK76388  93 DDFQFNHKEVFYEGKGQTVHFHPTskstgkdPAWGYNWDEDQGGGKWPNPFFFYLARMCNHCTNPACLAACPTGAIYKRE 172 Azoarcus sp. EB1
AAY27748  86 VPFEFDYAGRLFEGKKERARPSPT-------PRYAPNWDEDQGAGEYPNNSFFYVPRMCNHCAKPACLEACPNEAIYKRE 158 Dechloromonas agitata
CAD22070 103 RAWEFNHEEIMYEGSDEPLRPRDG-------AEWGPNWDEDQGAGEYPNSYYFYLPRICNHCTHPSCVEACPRSALYKRQ 175 Haloarcula marismortui
2IVF_B   173 DNGIVLVDQERCKGHRHCVEACPYKAIYFNPVSQTSEKCILCYPRIE------KGIANACNRQCPGRVRAFGYLDDTTSH 246 Aromatoleum aromati...
Q9S1G9   155 EDGLVVVDQSRCKGYRYCVKACPYGKMYFNLQKGTSEKCIGCYPRVE------KGEAPACVKQCSGRIRFWGYRDDKDGP 228 Thauera selenatis
Q8GPG3   154 EDGIVLVDQERCRGYRYCITACPYKKVYFNEQISKAEKCIFCYPRIE------KGLPTACAKQCVGRIRFIGYLDDEAGP 227 Rhodovulum sulfidop...
AAK76388 173 DNGIVLVDQERCKGHRHCVEACPYKAIYFNPVSQTSEKCILCYPRIE------KGIANACNRQCPGRVRAFGYLDDTTSH 246 Azoarcus sp. EB1
AAY27748 159 QDGLVVIHQEKCKGAQACIQSCPYAKPYFNAQVNKANKCIGCFPRIE------KGVAPACVAECAGRAMHVGFIDDQESS 232 Dechloromonas agitata
CAD22070 176 EDGIVLVDQDRCRGYRYCVEGCPYKKVYYNTVSKKSEKCIFCYPRIEgegpdgETFAPACAEECPPQLRLVGFLDDEEGP 255 Haloarcula marismortui
2IVF_B   247 VHKLVKKWKVALPLHAEYGTGPNIYYVPPM--GARGFGEDGEITDKTRIPLDVLEGLFGPEVKRVLAVLHTERENMRAGR 324 Aromatoleum aromati...
Q9S1G9   229 IYKLVDQWKVALPLHAEYGTEPNVFYVPPMntTPPPFEEDGRLGDKPRIPIEDLEALFGPGVKQALATLGGEMAKRRKAQ 308 Thauera selenatis
Q8GPG3   228 VHLLVERYKVAIPLHPEWGTKPSVFYVPPL--APPRIGDDGEPTEETRVPLAYLKELFGEAVVPALETLKTERAKKQSGA 305 Rhodovulum sulfidop...
AAK76388 247 VHKLVKKWKVALPLHAEYGTGPNIYYVPPM--GARGFGEDGEITDKTRIPLDVLEGLFGPEVKRVLAVLHTERENMRAGR 324 Azoarcus sp. EB1
AAY27748 233 VFKLVKRFGVALPLHPEYGTEPNVFYVPPVl-GPRVEMPNGEHTADPKISMTQLEQLFGKQVREVLKTLQAEREKKIKNQ 311 Dechloromonas agitata
CAD22070 256 IHKLVNEYEVALPLHPEFRTQPNVYYIPPF--APGQHTEDGETVDIDRIPRQYLRDLFGDGVDQALDTIERERQRARQGE 333 Haloarcula marismortui
2IVF_B   325 GSELMDLLISKKWSDRF 341 Aromatoleum aromaticum EbN1
Q9S1G9   309 ASELTDILIGYTNKDRY 325 Thauera selenatis
Q8GPG3   306 ESELMDTLIGYRHPEMF 322 Rhodovulum sulfidophilum
AAK76388 325 GSELMDLLISKKWSDRF 341 Azoarcus sp. EB1
AAY27748 312 PSELMDILIGRRSADMM 328 Dechloromonas agitata
CAD22070 334 DSELMELLQDKNPAKQY 350 Haloarcula marismortui
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap