Conserved Protein Domain Family
incFII_RepA

?
TIGR03474: incFII_RepA 
incFII family plasmid replication initiator RepA
Members of this protein are the plasmid replication initiator RepA of incFII (plasmid incompatibility group F-II) plasmids. R1 and R100 are plasmids in this group. Immediately upstream of repA is found tap, a leader peptide of about 24 amino acids, often not assigned as a gene in annotated plasmid sequences. Note that other, non-homologous plasmid replication proteins share the gene symbol (repA) and similar names (plasmid replication protein RepA).
Statistics
?
PSSM-Id: 132514
View PSSM: TIGR03474
Aligned: 3 rows
Threshold Bit Score: 491.085
Threshold Setting Gi: 132337
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P03066     9 YRQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSRFDFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLAN 88  Escherichia coli
CAA08925  11 YRQVKNPNPVFTPREGKKTLPFCRKLMAKAEGFTSRFDFSIHVAFLRSLGKRHRMPPLLRRRAIDALLQAMCFHYDPLAN 90  Klebsiella pneumoniae
AAC62601  16 YRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFTSRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLAN 95  Yersinia pestis
P03066    89 RVQCSITTLAIECGLATESAAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTSALFAALDVSEEAVAAA 168 Escherichia coli
CAA08925  91 RVQRSITNMAIECRLATESKSGNLSITRATRALKFLAELGLITYQTEYDPQIGCNIPTDITFTPALFSALDVSEVAVVAA 170 Klebsiella pneumoniae
AAC62601  96 RIQRSITNLAIECGLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSALDVSDVAVAAA 175 Yersinia pestis
P03066   169 RRSRVVWENKQRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIKRARARRDADRERQDIVTLVKRQLTREIAEG 248 Escherichia coli
CAA08925 171 RRSRVEWENKQRKKQKLKPLEMDELIAKAWRFVRERFRSYQSERKSHGRKRATARRDASRQRKDIETRVRQQLTREYATG 250 Klebsiella pneumoniae
AAC62601 176 RRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAHGLKRARARRDVDRTRRDIEAIVNRQLTREIAEG 255 Yersinia pestis
P03066   249 RFTANREAVKREVERRVKERMILSRNRNYSRLATA 283 Escherichia coli
CAA08925 251 RFRGDHEALKREVERRVQERMLLSRGNNYTRLATV 285 Klebsiella pneumoniae
AAC62601 256 RFVGNLDAVRREKARRVKERMLMSRNNNYTRLATG 290 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap