Conserved Protein Domain Family
HpnK

?
TIGR03473: HpnK 
hopanoid biosynthesis associated protein HpnK
The sequences represented by this model are members of the pfam04794 "YdjC-like" family of uncharacterized proteins. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0976) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnK) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and a radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL.
Statistics
?
PSSM-Id: 132513
View PSSM: TIGR03473
Aligned: 8 rows
Threshold Bit Score: 397.575
Threshold Setting Gi: 497575870
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010941812   1 MKRVIINADDFGLSDGVNRAVIKAWQEGILTSASLMVGGDAFHEAVHLAKANPGLHVGLHLTLVQGRAVGEHGGFPSICD 80  Geobacter sulfu...
WP_011240827   1 MKKLIVTADDFGAATVVNEAVEKAHIDGVLTAASLMVGAPAAFDAVERARRLPKLGVGLHLVLVEGRPVLPPDEIPDLVD 80  Zymomonas mobilis
WP_011492835   9 QRMLIITADDFGLHPRVNEAVELAYRHGVLTAASLMAGAPAAEDAIARARSLPGLCVGLHLVLADGMPVLPRESIPALVD 88  Burkholderia xe...
WP_011385476   2 SKRLIVTADDFGRSLEINRAVEDGHANGILTAASLMVTEGAVDDAVERARRLPGLGVGLHVTLVDGIPALAPSQIPDLVD 81  Magnetospirillu...
WP_012536986   6 GRRVIFNADDFGLDMAVNEAVESAHRDGVLTTASLMVAAPAAADAVARARALPGLGVGLHLTLVDGTPLLPAEQVPDLVD 85  Acidithiobacill...
WP_011517845   4 GQLLIVTADDFGLHHDINEAVERAHCQGILNAASLMVSSPAAADAVERARRLPGLRVGLHLVLADGVATLPYDQIPDLVD 83  Cupriavidus met...
WP_009890054   8 PRALIFTADDFGLHERVNAAVERAHRDGVLSAASLMVGASAARDAVERAKRLPSLAVGLHIVLADGPATLPAREIPALVG 87  Burkholderia th...
WP_011252190   6 LRRAIVSADDFGMSLEVNEAIEQAHRNGILSTTSLMVAGDAAEDAIRRAKTMPDLKVGLHVVAIEGKSVL---DLPAITD 82  Gluconobacter o...
WP_010941812  81 SKGAFSDDPVQTGMRYFFIRSFRKQLYREIEAQIVRFLQTGLPLSHVDGHLNIHMHPVVFDLLCGLMRKHGITTFRLCRE 160 Geobacter sulfu...
WP_011240827  81 RDGMFRRNMVRAGVDIFFRPGVRRQLVREINAQFSAFAATGLKLDHVNAHKHFHLHPTISNLILAIGRRYGLKAMRAPVE 160 Zymomonas mobilis
WP_011492835  89 GEGRFGSNMVRDGFRFYFLPHVRAQLALEIRAQFEAFAKTGLPLDHVNTHKHFHLHPTVLSLIIEIGRDFGMRAMRLPGE 168 Burkholderia xe...
WP_011385476  82 GNGLFTLDLVRLGTRIFLSKAAQRQVSAEMRTQFELFKATGLPLAHVDFHHHYHQHPTVFALVLDLAVEYGAPGIRIPWE 161 Magnetospirillu...
WP_012536986  86 EQGRFAADLWRRGVRYFFLPQVRKQLAAEIRAQFAAFAATGLELDHANAHKHLHLHPTVLTQMLEVGKEFGLRAVRLPWE 165 Acidithiobacill...
WP_011517845  84 ASGRFGSAMVRDGFRFFFLPRVRAQLAAEIRAQFEAFAATGLPLDHVNAHKHFHLHPTVLSLILSIGRDYGMRAVRLPRE 163 Cupriavidus met...
WP_009890054  88 PDGRFRDAMAKDGCRFFFLPHVRAQLRREIRAQFEAFAATGLALDHVNTHKHFHLHPTVLSMIVDIGREFGLAAMRLPYE 167 Burkholderia th...
WP_011252190  83 EQGWFGRNQLRLGVEYFFCPAARHALRREIAAQFRAFAATGLTLDHANAHKHMHLHPTVGHFLIESGLEHGLQAVRSPFE 162 Gluconobacter o...
WP_010941812 161 NlRANLTLDRERRFGKMVdaFIFSKLaG--RCRPILDHLGIGYAQEVKGLLNSGRMTEEYLLRVLDTLED-GTTELYFHP 237 Geobacter sulfu...
WP_011240827 161 PiNILAEIEPVTRHLPDY--VAMPWA-Y--GIRKRSVNAGLLVPDQTFGIAWTGHMTPHRMLGLIEHLPE-GLSEIYVHP 234 Zymomonas mobilis
WP_011492835 169 ------------RNAPLW---LRPWM-S--LVRARLDRAGIAHNDYVIGLADTGHMNESAWLAALERLPG-GVGEIYCHP 229 Burkholderia xe...
WP_011385476 162 P-PLLSYRARGDRLGTRLsnGLFHWR-RnrAMAAKAKARGLVVNERAFGLNDSGQMDAAKVNSFLGVLPE-GLSEIYCHP 238 Magnetospirillu...
WP_012536986 166 PlRAARCSGAKGVAPTFWsiFLAPWL-A--RMRRQLDRRRIMHNDQLYGLDATGHMDEERLLRMLRCLPAtGVTEIYLHP 242 Acidithiobacill...
WP_011517845 164 A-GGPLLLRPWLALL-----------------RARLQRAGIAYNDYVLGLSDTGAMDEATLLAAFEQLPR-GVVEMYLHP 224 Cupriavidus met...
WP_009890054 168 P------------STPFW---LKPWI-A--LVRARLDRAGIAHNDYVVGIERTGAMDEAALLAALAKLPA-GVGEIYSHP 228 Burkholderia th...
WP_011252190 163 P------PEPVEANDTLGdrALRHWI-G--VLRHQIRKAGLKTNDWCFGLRWSGHMTPDHIRGLIPRLPE-GTSEIYFHP 232 Gluconobacter o...
WP_010941812 238 GCLPCAEITRrmPDYRHEEELAALMSPRVKGRLKELGIELGNYRGEVK 285 Geobacter sulfurreducens
WP_011240827 235 AVSDEYEGHA--QGYESIEEWHALTDEAVKKALKERQIELGNFSDFLG 280 Zymomonas mobilis
WP_011492835 230 ATAGDAPLTPgmQSYRHADELDALLSPRVAEAIGAAGATRGGFADLLA 277 Burkholderia xenovorans
WP_011385476 239 ATAHWSGARPmpPHYRIDDEYKALIAPENRRKVEELGITLTTFAAEAR 286 Magnetospirillum magneticum
WP_012536986 243 AMVQTAALHAlmPNYEPHAEWAALTSPRVKDYLRDQDIAKGTFRDFVA 290 Acidithiobacillus ferrooxidans
WP_011517845 225 AVTSGAEVGAsmTGYRHADELAALLSPRVRAAADRFAPRRGGFTDLHA 272 Cupriavidus metallidurans
WP_009890054 229 AEAGDGPITPsmRDYRPADELAALLSPRVAAAVQAAGVACGGFADVFG 276 Burkholderia thailandensis
WP_011252190 233 ATAQNSMMKRfmPGYEQESELAALLDPAVRASFDRYGVTRIGWADL-- 278 Gluconobacter oxydans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap