Conserved Protein Domain Family
HpnI

?
TIGR03472: HpnI 
hopanoid biosynthesis associated glycosyl transferase protein HpnI
This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0974) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnI) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and another radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL. Hopanoids are known to feature polar glycosyl head groups in many organisms.
Statistics
?
PSSM-Id: 132512
View PSSM: TIGR03472
Aligned: 9 rows
Threshold Bit Score: 463.773
Threshold Setting Gi: 499620280
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011252192   5 LTIAAGFCALVSAAGNLQALAGATLLARFRR------T-ERRADdalrlsdRTW--PSVTVLKPLHGNEPLLEDALESVF 75  Gluconobacter o...
WP_011240825   9 LTIIGSLALLMALAGVGYTILAAIVVLWWQQ------K-EVIKR-------KAW--PSVSLVKPLHGDEPALTENLLTFL 72  Zymomonas mobilis
WP_009893405  33 acllaapcaiaaaFGCAYTLVAAALTHRFFA------R-APREP-------RAC--PPVTIVKPLHGNEQTLFANLASFC 96  Burkholderia th...
WP_010941358   1 mtpdtllpllavlpplaYGLLALFCARAWFG------R-QRPGP-------GHT--PPVTILKPVKGMDAESFENFASFC 64  Geobacter sulfu...
WP_011385844   5 WQGLCLVLIALTVAGCLFQVASAALVRRFRR------A-PEPVP-------AAR--PPISVMKPLCGAEHGMAANLDSCL 68  Magnetospirillu...
WP_004527445   5 LSIVGWVLLALVCASCGYAVLAACAPAPRVP------R-AARAR-------DGF--EPVSVLKPLCGSEPHLYENLATFC 68  Burkholderia ps...
WP_011354082  11 AGAMSIVCGLGVLLGIAYTITASVLVGRFFS------R-AADEP-------RDY--PGVTVAKPLHGDEWQLVQHLESFF 74  Burkholderia lata
WP_009566461   2 CWWIGGPAALLSLAAVVYLLLALRAIARWHPvlperdA-AVSGD-------ILCdgPGVSVLKPLHGDEGDLYAALRSFC 73  Acidithiobacill...
WP_011301014   7 AMAATLLGSALTCVSAGYAVAAAVLTRRAGA------RaPAAAA-------AGE--VRASVLKPLCGAEPRLYDNLATLC 71  Cupriavidus pin...
WP_011252192  76 TQDYPD-FQIVFGVQDREDTALAVIERLRARHPRIPVSVVINPQEHGPNRKVGNLMNMYGEARHDIIVISDSDIHASPNY 154 Gluconobacter o...
WP_011240825  73 KQDYPAeYEMLCGIQNPDDPAGETVREIASTSNQTAVRLIVDSKSHGTNAKISNLINITAHIGHDILIISDSDMSVPEGY 152 Zymomonas mobilis
WP_009893405  97 EQRYDGpIQFLFGVHDRDDPALRAVDALRDAFPGAHVTIVADARLYGPNRKIANLVNMLPAAVHDVLIFADSDVSVGPDY 176 Burkholderia th...
WP_010941358  65 RQEYGGpWQMLFACASADDPVIPVIRRLMAEFPDRDIDLVVDGTIHGPNYKVSNLINAFPRARHDILIVCDSDIRVTSDY 144 Geobacter sulfu...
WP_011385844  69 RQDYPR-FQLVFGVADPADPALDVVKALPGDVEGAEIDWVADSARHGHNLKVGNLLNMWPKVRHDVIAIADSDIRVGPHY 147 Magnetospirillu...
WP_004527445  69 EQRHPR-YQLLFGVASAADPAIAVVRRLQADYPDCDIELVIDARVYGSNLKVSNLVNLAERARHGRIVIADSDIAVEPDY 147 Burkholderia ps...
WP_011354082  75 VQNYPGpVQHLFGVHDANDKALAAVETLRARYPDANIKVVADARLYGPNRKIANLVNMLEHAEYSVLCLADSDVLVERDY 154 Burkholderia lata
WP_009566461  74 VQDYPA-FEIVFGVQRPDDPAVTVVQRLQAEFPALALRWVCTEARIGSNPKVNNLAGILALCRYDTLVISDADISVGPHY 152 Acidithiobacill...
WP_011301014  72 RQSVTG-YQVVCGVRDPDDPAIAVVRRLQQDFPDIDITLVIDPRVHGSNLKVSNLINLAAHARHDLLVVADSDIAVPPDY 150 Cupriavidus pin...
WP_011252192 155 LRHVVTSLKEQGTGLVTTLYAGRPAAGtIVQQLGACQINHNFLPGVMMSRFLGRQD-CLGATMALRRQTLEEIGGLEALV 233 Gluconobacter o...
WP_011240825 153 IRQVVHALEKKDVGAVTCLYHGRGDNG-YWSRLSAANIDYNFLPSVMVGVALRKANpCMGSTIAIKRETLEAIGGFNSLA 231 Zymomonas mobilis
WP_009893405 177 VRHIVGELDEPDVGLVTCVYRGRPDPG-FWPRVEALVTNHQFLPGVVTGLALKLARpCFGQTIAMRRATLDAIGGLAQFA 255 Burkholderia th...
WP_010941358 145 LGEVTAPFADPAVGLVTSLYRSPGVRG-AATALEAMGFTVEMVPNVMVAQRLEGLSfALGASMAVRRTALESIGGFPALT 223 Geobacter sulfu...
WP_011385844 148 LDDLAAPFDDPKVGIVTCLYVGRPEPD-LWSSLGAMGINHGFLPGAVLARAIGRKDgCFGATMAVRREVLEKGGGLAALS 226 Magnetospirillu...
WP_004527445 148 LTRVTAPLADPSVGVVTCLYHARSVGG-FWTRIGAQFVDAWFAPSVRITHLGGSSRfGFGATLALTRATLDAIGGFKALK 226 Burkholderia ps...
WP_011354082 155 LRAVVGALQQPDVGIVTSVYRGIASPG-FWPGVAVAMTNYHFLPGVITGLFIGRARpCFGQTIAFTRATLERIGGLTRFA 233 Burkholderia lata
WP_009566461 153 LRQICASLQNRDVGVVTCLYRARPVAT-FWSRVLAGQVNGLFLPSVLLAARLGPNIfCGGATMALRRPTLAAIGGLPRLA 231 Acidithiobacill...
WP_011301014 151 LARVAAPLADPGVGIVTCLYRGRPVDA-FWAKLGAQFIDDWFAPSVRIAHAGGSRRfAFGATIALRRDTLTQIGGFASLS 229 Cupriavidus pin...
WP_011252192 234 DHVADDAELGQLIRARGENITIAPTLTHTTVGEHSISDLLAHELRWGRTVKNVAPVGYGLS--AIQLPLFWAVTAVLFrp 311 Gluconobacter o...
WP_011240825 232 NILADDYVLGAKVRALGLRVEVIPVILTHSCTETSFSSLVRHELRWSATIRDINPVGFFGS--AVTYPVPLAFIGLML-- 307 Zymomonas mobilis
WP_009893405 256 HHLAEDHAIGEAVRACGARVVVPPFAIEHGCVETRVAQLVEHELRWSRTIRAVDPRGHLGSllTHPLALALLASVLSS-- 333 Burkholderia th...
WP_010941358 224 HYLADDYQLGNKIHRAGWRLELSDCFVESVMHRENLTTVLSRQLRWCRTMRASRPGGYLGS--GITQPVPLACLALLVsg 301 Geobacter sulfu...
WP_011385844 227 QVLADDWVLGRMVRDQGLEIVLAARPVDMNVHEPSLKTLLDHEIRWGRTIAAVDRTSYMAS--VITQPVALAALAVLA-- 302 Magnetospirillu...
WP_004527445 227 DELADDYWLAELPRRLGLRTVLSEVNVATDVAEPSFAPLWLRETRWLRTIRSLNPAGFAFL--FITFTAPWLVIGAAL-- 302 Burkholderia ps...
WP_011354082 234 HHLAEDHALGEAVRQVGAQVVIPPFVVGHACVEETFAKLYAHELRWSCTIRAADRLGHAGS--VLMHPVPLALLALLFsg 311 Burkholderia lata
WP_009566461 232 NQLADDYWLGAYSRQLGQATLLADYVVDTEVREANFRAFYQHALRWSRTTRSVQPLGHTFS--F----LTYPLPLVLL-- 303 Acidithiobacill...
WP_011301014 230 DRLADDFWLGELTRQAGLRTVLSDVVVTTDVTETRLPELWTHELRWLRTIRSLNPAGFAFT--FITFTWPMLVVGVVL-- 305 Cupriavidus pin...
WP_011252192 312 NAWW-TWF------MLLLTW---LVRAIGSRIMDRAT---ECPLPAAIp---L-LVVRDWLSAAIMVGSARGSRVAWRGR 374 Gluconobacter o...
WP_011240825 308 TNGWvSWP------VFCLAL---ASRWLLGWRINRVT---GVSRMDAL----LqLPFRDLLSFGIFLSTFFISSVDWQGM 371 Zymomonas mobilis
WP_009893405 334 GAAW-AWP------LVPASL---AARAVSKCIVDHAT---KRPVRDLW----P-LPLADLIAFGIFVASFSSSRVIWRGF 395 Burkholderia th...
WP_010941358 302 CSAA-GWG------AVILLY---LTRALVAVTFSRRYlrdGIFPRWLW----L-LPLRDILAFATWALSFAGNRVRWRGN 366 Geobacter sulfu...
WP_011385844 303 GGAW--WP------SVAALAlavLCRLWAVRVEERAL---GLPRCGLG----L-LGMREILSFVVYVVACCGRTVVWRGR 366 Magnetospirillu...
WP_004527445 303 -AAW-LGPasaagaTAAWAA---AIGTLARLALHARG---AAGWRAFWrdlpL-VPVRDALLALEWLAAAFGTQVVWRGA 373 Burkholderia ps...
WP_011354082 312 GTTA-ACG------LVAAAL---AARALLMLKTSRAT---GAGLRGAL----W-LPFVDLLQFFVFVSSFFSSHVVWRGT 373 Burkholderia lata
WP_009566461 304 LAPW-MGL------WGGVPL---GVVLLLRLVYHRQImhkLSADGSFG----V-ALLGEFLGLWIWFHALFARHVAWRGS 368 Acidithiobacill...
WP_011301014 306 -SPA-EWT------TAIA-----VAGALARSAMARTP---TTALRA---------PLRDTLLLIGWAAALGGQRVRWRQQ 360 Cupriavidus pin...
WP_011252192 375 TVHIARRKRNSAS 387 Gluconobacter oxydans
WP_011240825 372 ELTLHSDGRISRK 384 Zymomonas mobilis
WP_009893405 396 SFDVDRDGRLCPA 408 Burkholderia thailandensis
WP_010941358 367 LFRLLPGGKIVEI 379 Geobacter sulfurreducens
WP_011385844 367 RFAVRADGTLDQV 379 Magnetospirillum magneticum
WP_004527445 374 RMTVVGGDARATV 386 Burkholderia pseudomallei
WP_011354082 374 RFRVDREGLLSPA 386 Burkholderia lata
WP_009566461 369 QFAIGADGRMDGH 381 Acidithiobacillus ferrooxidans
WP_011301014 361 VLSVQDPA----- 368 Cupriavidus pinatubonensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap