Conserved Protein Domain Family
HpnJ

?
TIGR03471: HpnJ 
hopanoid biosynthesis associated radical SAM protein HpnJ
The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0975) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4901) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnJ) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and another radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Statistics
?
PSSM-Id: 132511
View PSSM: TIGR03471
Aligned: 8 rows
Threshold Bit Score: 895.999
Threshold Setting Gi: 499705109
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012536987   3 MKTLFLQAPSFEGFDGGAGSRYQAKREIRSFWFPTWLAQPAAMIPGSRLLDAPPADVSVEETLQVAAGYDLCIIHTSTPS 82  Acidithiobacill...
WP_011301015   2 KKTLFLQAPSFDGFDGGAGSRYQAKREIKSFWYPTWLAQPAALVPGSRVLDAPADELTPQQTLDIAVDYDLVIVHTSTPS 81  Cupriavidus pin...
WP_011614172   2 KKTLFLNPPSFDGFDGGAGARYQAKREITSFWYPTWLAQPAALVPGSKLVDAPAHYQTVEDVLKIAKDYELVIMHTSTPS 81  Trichodesmium e...
WP_011523121   3 LKTLFLNPPSFENYDGGASSRWPATREIESYWYPVWLAYPAGMLEGSRLLDAPPHHVSFDETIQISKDYDFVVLFTSTPG 82  Candidatus Kori...
WP_011240826   2 MRTLFLQAPSFDGFDGGAGSRYQARREIKSFWYPTWLAQPAALIKDSKLIDAPPHGTKLPEVLAIAPDYDLAILHTSVPS 81  Zymomonas mobilis
WP_011689127   1 MRTLFLNPPSFEGFDGGASSRWPASREIESYWYPVWLCYPAGMLPDSRVVDAPPHKISIEQTVEMGKDFELLVLYTSTPG 80  Candidatus Soli...
WP_004512484   1 MKPLFLNPPTYEDFDGGAGARYQASREVTSFWYPTWLCFPAGMIDGSRVVDAPVQRFTIDDCLAIARDFDMVVMYTSTPT 80  Geobacter metal...
WP_011385843   2 KKSLFLNPPSFEGYDGGAGARFQAKREIKSNWYPTWLAQPAAMVPGSKLVDAPASGKTLDDCLKLAKDYELLVIYAGAAT 81  Magnetospirillu...
WP_012536987  83 FPSDVRMAEVLKEHYPKLLIGMVGAKVAVEPEESLQQAA-AaVDFVAREEFDYTLKEIAEGRPLSEVDGITYRSSNGQII 161 Acidithiobacill...
WP_011301015  82 FPTDAKFAEELKKRKPGVMIGMVGAKPAVDPGGTLGASG-A-IDFVCREEFDYTCQDVAAGKPLKDILGLSYRLPDGSLE 159 Cupriavidus pin...
WP_011614172  82 LPNDIKCAEAIKNQNPETKIGFVGAHVAVLPEKTLKDHP-I-IDFVCRNEFDYTCKELSQGKPFAKIKGLSYYDTQGNIH 159 Trichodesmium e...
WP_011523121  83 FPGDLKIAKAMKTANPNVKIAFVGPHVTTLPERSLAEGP-E-IDFIVRREFDYAVVEYANGKPLNEITGVSYRGADGKVV 160 Candidatus Kori...
WP_011240826  82 FASDVKTVAALKKVNPAMKIGFIGAKVAVEADKSLKDAKgI-VDFVARNEFDFTIKDVADGKDWSEILGLSYINDKGEIV 160 Zymomonas mobilis
WP_011689127  81 FNIDVKMATMMKDVNPKLKVAFVGPPVTTEPDKTLIGTK-A-IDFVVRREFDHQIVDYAKGKPLEELPGVSFR-KNGHIV 157 Candidatus Soli...
WP_004512484  81 LALDIATARRVKEQKPATVTVLTGPHVSVLPEETLRQGEgV-IDIVCRGEFDYTTKELCEGREWAKVDGISFW-KDGKIH 158 Geobacter metal...
WP_011385843  82 YASECKVAEAFKAANPNIMIGMVGAHVATVPEPSLLASD-A-IDFVARHEFDYTIVEVAEGKPFAEIDGLTFRGEDGKPV 159 Magnetospirillu...
WP_012536987 162 HNPDRAMIEDMDALPFVSEVYKRDLHIEDYFIGYLKHPYISFYTGRGCRSQCTFCLWPQTVGGHRYRTRSAASVIEEVRY 241 Acidithiobacill...
WP_011301015 160 HNGQRPMIENMDELPFVAPVYKRDLKIENYFIGYLKHPYVSIYTGRGCRSRCTFCLWPQTVGGHRYRTRSAESVIAEVKW 239 Cupriavidus pin...
WP_011614172 160 HTPERELIHDWDAMPSVFPVYAEHLNIRNYLIGYLLNPYISLYTGRGCPAKCTFCLWPQTIGGHQYRAKSPEAVGREMAE 239 Trichodesmium e...
WP_011523121 161 HNPDRPPVSNLDEMPDVIDVYKRDLDVKRYNVPFLLHPYIALYTTRGCPAQCTFCLWPQTLSGHPWRKRSSDAVASEMKR 240 Candidatus Kori...
WP_011240826 161 HNADRPLLQNMDELPFVTPIYKRDLEIEKYFIGYLKHPYISIYTGRGCKSHCSFCLWPQTVGGHKYRTRSVEHVIEEIKY 240 Zymomonas mobilis
WP_011689127 158 NNPEGPAIEDLDALPWVTKVYKRDLDITRYNVPFLLNPFVSLYTSRGCPALCTFCLWPQTHSGHRWRLRSSDDVANEVRY 237 Candidatus Soli...
WP_004512484 159 HTPDRPPIQDLDALPFVAPVYKRDLPIAEYVIPHFKNPYVSIYSSRGCPSKCIYCLWPQTFSGRAMRTRSPQNVYEEVKW 238 Geobacter metal...
WP_011385843 160 HTKDRAMIHDMDALPFVGPVYRRDLNPDDYFIGYIRHPYMAFYTGRGCKSKCSFCLWPQTIGGRVYRARSAKSVIEEVTL 239 Magnetospirillu...
WP_012536987 242 IQKNF-PQVKEIFFDDDTFTDDRPRAEEIARGLGKLGVTWSCNAKANVPYDTLKVLHENGLRLLLVGYESGDQQILNNIK 320 Acidithiobacill...
WP_011301015 240 IKENM-PEVKEIMFDDDTFTDFKPRVEEIARGLGKLGVTWSCNAKANVPYSTLKIMKENGLRLLLVGYESGDDQILLNIK 318 Cupriavidus pin...
WP_011614172 240 AKAIWgSSVREYFFDDDTFTIDKKRAIAISEHLQRLKLTWSCNARGNLDYNTLKELKKNGLRLLLVGFESGNQKILDGVN 319 Trichodesmium e...
WP_011523121 241 AMELF-PWVREFFFDDDTFNIQKARTIELCEKLKPLGMTWSCTSRVTTDYETLKAMKEAGCRLLIVGYESGDPQILKNIK 319 Candidatus Kori...
WP_011240826 241 ALKTF-PQVKEFFFDDDTFTDDRPRAEAIARELGKLGVTWSCNAKANVPYETLKVLKDNGLRLLLVGYESGNQQILHNIK 319 Zymomonas mobilis
WP_011689127 238 ALEQF-PQMKEIFFDDDTFNYRKERTIELCKKLKPLNFTWSCTSRVTTDYETLKAMKEAGCRLLIVGYESGDQQILKNIK 316 Candidatus Soli...
WP_004512484 239 IVDNI-PEMRELSFDDDTFTADRKHAREVAAKLKPLGISWTINARANCDYETLKIMREAGLRHVVVGYETGNEQILKNIK 317 Geobacter metal...
WP_011385843 240 ARQMF-PEVREFFFDDDTFTDDLERVEEIAKGIGHLGVPWSCNAKANIPRKTLEVLKANGLRVLVVGYESGVQEILNNIR 318 Magnetospirillu...
WP_012536987 321 KGLKVEAARKFTADCHKLGIVIHGTFILGLPGETKETIQKTIDFAKEINPHTIQVSLAAPYPGTFLYNQAKQEGWLTDED 400 Acidithiobacill...
WP_011301015 319 KGLRTDIARRFTEDCRKLGIQIHGTFILGLPGETQQTIEKTIAYAKEINPHTIQVSLAAPYPGTTLYQQAVDNGWLEENK 398 Cupriavidus pin...
WP_011614172 320 KGIKLEVARKFMENCHKLGIKVHGAFILGLPNESQETIEETIRFACEVNPHTIQVSIASPYPGTELYTQAEKNGWFTGDS 399 Trichodesmium e...
WP_011523121 320 KGATVERARAFTKDCHKLGLKVHGDFILGLPGETKETIRRTMDFAKELDVETIQVSIAHAYPGTELYDYAKANGFIVQEG 399 Candidatus Kori...
WP_011240826 320 KGMRVETAEKFTRDCHDLGIAIHGTFILGLPGETRETIEQTIKWACEINPHTIQVSLAAPYPGTLLYKQAIENGWLDQSH 399 Zymomonas mobilis
WP_011689127 317 KGATVDMAERFTANCKKLGLLVHGDFIIGLPGETRESIRKTIDFAKRLDNETIQVSIAHPYPGTEFYDYVKQNGLITIDS 396 Candidatus Soli...
WP_004512484 318 KGVTKEQAIEFTRNCKKLGLSVHGAFIMGLPGETRDTIRETIEYAKALDLNSIQASLASPYPGTEFWDLCRQEGWIASEA 397 Geobacter metal...
WP_011385843 319 KGLRIDIIKRFSQDCHELGIVVHGTFILGLPGETRETIKQTLAFAKEVNPRTLQVSMAAPYPGTELYEQAIANGWFKQDK 398 Magnetospirillu...
WP_012536987 401 EAHl--VNDRGVQISPMSYPHLNHTEIFDSVEVMYKRFYFRAGKIAEITGEMLKSTQMMKRRLREGVEFVRFLRQRHG 476 Acidithiobacillus...
WP_011301015 399 VINl--VNDKGVQLAAISYPHLSKEEIYHGVERFYKQFYFRPGKIWEIVREMLGSWDMMKRRLREGVEFFRFLRSHEA 474 Cupriavidus pinat...
WP_011614172 400 --L---VASSGIQMSALQYPHLSGSEIEDGVEQMYRRFYFRPKSIIPIVGEMLADPQMLVRRLREGKEFLSYLRERHQ 472 Trichodesmium ery...
WP_011523121 400 AAM---VDDQGHQVAMIEYPGLPRDYVMEMVHKFYDEYYFRPKAIFRIVRKAVFNNVERKRLYKEAKDFMKLRSVRNK 474 Candidatus Koriba...
WP_011240826 400 AEL---VDEHGVQIAPLSYPHLSHEEIFRSVETFYKRFYFRPGKVFSIVNEMVRDFDMMKRRLREGVEFFQFLRERKE 474 Zymomonas mobilis
WP_011689127 397 --M---TDENGHQLPNVVYPGLDRGELVEWVERFYGEYFFRPKVVWRIVRKAIFNSDERRRLTKEAREYMALRSKRRK 469 Candidatus Soliba...
WP_004512484 398 Y-----IDDTGHQMCVINYPHLSNKEIFDAVELFYNKFYFRPKYIGRSIMKMIVDGEERKKLLKEGKQYLEYMRKRKA 470 Geobacter metalli...
WP_011385843 399 DLVmkeTGGGGWQVAALSYPDLSSEEIFKGVAEFYKAFYFRPSKIGEIVWEMLHDWDMMKRRLREGVEFFQFLRTRNK 476 Magnetospirillum ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap