3WJ7


Conserved Protein Domain Family
HpnA

?
TIGR03466: HpnA 
hopanoid-associated sugar epimerase
The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnA was assigned. Hopanoids are known to be components of the plasma membrane and to have polar sugar head groups in Z. mobilis and other species.
Statistics
?
PSSM-Id: 163279
View PSSM: TIGR03466
Aligned: 15 rows
Threshold Bit Score: 487.2
Threshold Setting Gi: 499424297
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WJ7_A        14 DVTLVTGATGFVGSAVARVLEERGHRLRLLVRPTSDRSNIAELNAELAVGDLSDPDTLAPALKGVKILFHVAADYRLWVP 93  Gluconobacter o...
WP_011493166   7 DLVLVTGASGFVGSSVARIAQQKGFKVRVLVRATSPRQNVESLDAEIVVGDMRDEASMRNALRGVRYLLHVAADYRLWAP 86  Burkholderia xe...
WP_010941347   1 MKVFVTGATGFIGASIVRELLKDGCHVRVLARPGSDRRNLAGLDVEICEGDLRDRQALEHGLAGCEVLYHAAADYRLWTR 80  Geobacter sulfu...
WP_011383774   3 GPVLVTGATGFVGAAIVRALLARGEAVRVLARPASDRRNVANLHVEVAEGRLEDAASLRKAMAGCRVLIHTAADYRIWVP 82  Magnetospirillu...
WP_010998406   1 MRVFVTGATGFVGANLVRLLLQQGYTVKTLVRPQSNLGNLRGLDVEIVEGDF-DNQFLWQQMSGCRYLFHVAAQYSLWQK 79  Nostoc sp. PCC ...
WP_011522544   1 MKAFVTGATGFVGSHVAELLEAMGAEVRVLTRKTSRSENLEMLKAERIVGDLRDFDSLKKGMAGCEVVFHVAADYRLWTR 80  Candidatus Kori...
WP_011240733  11 KPVLVTGVSGFVGSAVARSLAQQGYKVRGMVRATSPKTNIRDFPGEIVFGDLDDPPSLREPLSGCGALIHVAADYRLWAA 90  Zymomonas mobilis
WP_012536988   1 MKALLTGASGFVGGAVLRRLLAEGLEIRVLHRTGADPANWEGLDVELVVGDLTDGPALDSAVAGCQAVFHVAADYRLWVP 80  Acidithiobacill...
WP_011683031   2 KPALVTGASGFLGWHVARVLVERGLHVRALVRPGSK---VVGIDVECVTGDLRDPASLALAVKGCGLVFHVAADYRLWAK 78  Candidatus Soli...
WP_015895986   1 MKVLVTGATGFVGSHVAKELAAQGASLRLLVRKTSNLANLEGLNAETVTGDLMEPESLRTAVRGCEALLHVAADYRLWVR 80  Acidobacterium ...
3WJ7_A        94 DPETMMKANVEGTRNLMLAALEAGVEKIIYCSSVAALGLRSDGVPADETTPVSESQVIGIYKLSKYRAEQEVLRLIREKN 173 Gluconobacter o...
WP_011493166  87 DPSEIERSNLEGTEATMRAALKEGVERIVYTSSVATLKVTSSGQSADETSPLKADQAIGVYKRSKVLAERAVERMIAEDN 166 Burkholderia xe...
WP_010941347  81 TPAAMYAANVDGTRNILEAALRRGIARVVYTSSVGTLGNPGNGTPGTETTPVTFADMVGHYKKSKFLAEREAEAFIAR-G 159 Geobacter sulfu...
WP_011383774  83 DPAAMMKANVEGTRTLMEAALAEKVERVVYTSSVATLGH-VEGGVADEDTPSDISDKVGPYKQSKFLAEEVVRRMVAEQG 161 Magnetospirillu...
WP_010998406  80 DRDLLYQNNVLGTFQVLEAAQKAGIERTVYTSSVAAIGVNPSGEIADETYQSPVDKLIGHYKKSKFLA-EQEAVQAAAKG 158 Nostoc sp. PCC ...
WP_011522544  81 NPEEMYASNVEGTRSIIRAAQETGVRRVVYTSSVATMGFGYNGYIVNEATPVHAGMMIGHYKKSKFQAEQVALEMAQA-G 159 Candidatus Kori...
WP_011240733  91 DPNEIIRHNRLHTQAIMTAALYLGIERVIYTSSVATLA-PGHGKPSDENSPLMPENAIGAYKRSKVEAERLVEKMIAEQG 169 Zymomonas mobilis
WP_012536988  81 DPRAMYAANVGGSERLVRAALDAGVERIVYTSSVAVLGHYADGREADEDTTAQLEDMIGHYKRSKYLAEEALRALCREEG 160 Acidithiobacill...
WP_011683031  79 DPTELYRSNVDGTRNLLEAARQAGVERTVYTSTVGCIGMPRDG-IGDEAQPVKLAHMAGDYKRSKFLAEKVALEFARA-G 156 Candidatus Soli...
WP_015895986  81 DPKQMYAANVEGTRALLQMAREEGVGRCVYTSSVATMAFREDGTIVDEATPVSVDDMVGHYKRSKFLAEQVALEAAAAG- 159 Acidobacterium ...
3WJ7_A       174 LPAIIVNPSTPVGPRDIKPTPTGQMILDCASGNMPAYVETGLNIVHVDDVAEGHALALER--GKIGEKYILGGENIMLGD 251 Gluconobacter o...
WP_011493166 167 LPAVIVNPSTPIGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAAGHFLALER--GKIGERYILGGENLPLQQ 244 Burkholderia xe...
WP_010941347 160 LPLVIVNPSTPVGPHDVKPTPTGKIIVDFLNRKMPAYLDTGLNIIDVEDCARGHLLAARH--GRIGEKYILGHENLTLRE 237 Geobacter sulfu...
WP_011383774 162 LPAVICSPSTPIGPGDVKPTPTGRMIVEAASGRMPAYVDTGLNIVHVDDVAAGHLLALDK--GRIGERYILGGENLTLAD 239 Magnetospirillu...
WP_010998406 159 QDIVIVNPSTPIGPWDIKPTPTGDIILRFLRRQMPAYVNTGLNLIDVRDVAWGHLLALEK--GKSGDRYILGHQNLSLQQ 236 Nostoc sp. PCC ...
WP_011522544 160 ADVVIVNPSTPIGERDIKPTPTGQIVVDFLKKKFPAYVDTGLNLVDVRECAQGHINAMER--GRSGERYILGGENLTLKQ 237 Candidatus Kori...
WP_011240733 170 LPAVIVNPSTPIGPRDVKPTPTGRIIIEAATGKMPAYVNTGLNLAHVDDVADGHVKALEK--GVIGERYILGGADVPLSV 247 Zymomonas mobilis
WP_012536988 161 APIVIVNPSTPIGPADRKPTPTGRMVRDAAAGRMPAYVDTGLNVVHVDDVAMGHWQAFTD--GEVGERYILGGDNLPLAA 238 Acidithiobacill...
WP_011683031 157 QPVVIVNPTAPLGDHDVKPTPTGKIVLDFLKGDMPAFIDTGLNVVDVRDTAEGHWQACER--GRSGERYILGSENLTLAQ 234 Candidatus Soli...
WP_015895986 160 QAVIVLNPTTPIGPGDIKPTPTGRIVVDFLNRKFPAYMDTGLNLVDVKEVARTHVAALDPavGRPGERYILGGENLTLKQ 239 Acidobacterium ...
3WJ7_A       252 LFRMVSQIAGVKPPAVKLKQSWLYPVALVSEWLA-R-GFGI-EPRVTRETLAMSKKLMFFSSDKAKKELGYAPRPARDAV 328 Gluconobacter o...
WP_011493166 245 MLADIAALTGRKAPTLSLPRWPLYPLAMGAEAIA-K-ITKR-EPFVTVDGLKMSKNKMYFTSAKAERELGYRARPYREGL 321 Burkholderia xe...
WP_010941347 238 IFALLARLTGIPAPRVRLPHTPILMAAYVNEALA-K-LTGK-EPLIPLAGVQMAKKFMFFESSKATGELGLQRRPAVDAL 314 Geobacter sulfu...
WP_011383774 240 ILNRIAKITGGRPPLMKLPRWPLYPLALGAETWA-R-FFGG-EPFVTVDGLKMSRWHMFFSSAKAERELGYRHRPADEAL 316 Magnetospirillu...
WP_010998406 237 LLEKLAEITGLPAPQWTVPGWLPLSVAWMEEKIL-A-PLGK-TPSVPIDGVRMAQQTMYYDASKAVKELGLPQSPVDIAL 313 Nostoc sp. PCC ...
WP_011522544 238 ILDKLASISGLPSPKVKLPYAVALAAGAVDTVVT-GyIRGK-EPRANLDAVRMGRKKMYVSSAKAEADLGYKAGSANDGL 315 Candidatus Kori...
WP_011240733 248 MLAEIARQVGRKPPKVALPRWPLFPLAWGAEAFA-K-ITKK-EPFITSDALRMAGYHMYFSSEKAKRDLGYKSRPWQHAI 324 Zymomonas mobilis
WP_012536988 239 ILTRIAGLTGHRSPWLRIPRRLLYPLAWGAERVV-R-LRGRgTPLVTVDELRMAAHKMYFSSAKAERVLHYTHRPAEEAL 316 Acidithiobacill...
WP_011683031 235 ILQKLAAITGRKAPTLQLPYALAYCAGACSTAWA-A-VTGR-PPRVPLEAVRMAKKKMWVSHDKAARELGFQPGPAEKAL 311 Candidatus Soli...
WP_015895986 240 ILDKMSAITGLPSPTMKVSHGVAMAFAFFDETIQgK-LLGR-EPRATVESVRMGRKKMFASSAKAQRELGFRVVPVYEAL 317 Acidobacterium ...
3WJ7_A       329 TDAIAWFRQHGRM 341 Gluconobacter oxydans 621H
WP_011493166 322 GDALEWFRQAGYL 334 Burkholderia xenovorans
WP_010941347 315 RRAVEWFRANGYA 327 Geobacter sulfurreducens
WP_011383774 317 DAAVEWFKSIGEV 329 Magnetospirillum magneticum
WP_010998406 314 KDAVNWFVSQGYV 326 Nostoc sp. PCC 7120
WP_011522544 316 RRAAEWFRAHGYA 328 Candidatus Koribacter versatilis
WP_011240733 325 SDAIEWFRAEGML 337 Zymomonas mobilis
WP_012536988 317 RDAVRWFAEHHYL 329 Acidithiobacillus ferrooxidans
WP_011683031 312 RHAVDWFRQTAa- 323 Candidatus Solibacter usitatus
WP_015895986 318 REAIAWFRAHGYA 330 Acidobacterium capsulatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap