Conserved Protein Domain Family
HpnD

?
TIGR03465: HpnD 
squalene synthase HpnD
The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. In the organisms Zymomonas mobilis and Bradyrhizobium japonicum these genes have been characterized as squalene synthases (farnesyl-pyrophosphate ligases). Often, these genes appear in tandem with the HpnC gene which appears to have resulted from an ancient gene duplication event. Presumably these proteins form a heteromeric complex, but this has not yet been experimentally demonstrated.
Statistics
?
PSSM-Id: 163278
View PSSM: TIGR03465
Aligned: 20 rows
Threshold Bit Score: 303.048
Threshold Setting Gi: 499921890
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011602624  21 TKEAARNFSYGIRLLPPEKRGALSAVYALARHLDDIGDG-DLPPEEKLAGLAQVRAEVNNLGA---G-Ss----DPMYVA 91  Frankia alni
WP_011383776  20 VRASGSSFYWGMRLLDRPRRYAMYAIYAFCRVVDDIADE-PGDPEVKRAQLAEWRVELDRLYA---GaPt----HAVAKA 91  Magnetospirillu...
WP_011085786  14 STASGSSFYAAMRILPHDQREAMFQIYSFCRQVDDIADS-DGPREERLAALQAWRTDIDALYQ---GnPp-----PRLKD 84  Bradyrhizobium
WP_007178629  17 AATSGSSFYLAMRILPAAQRDAMYQVYAFCRAVDDIADS-DMPRAERAAALERWRADIDACYA---GaPr----TSL-RA 87  Burkholderia sp...
WP_011240736  25 SGAKSSSFYIGMRVLPPAEREAMYAIYNFCRQVDDIADDlEGSQEERKQALDAWRHDINALYA---GePc----GQAA-F 96  Zymomonas mobilis
WP_011387825 417 TKASGTSFYGAMRILPRERRLAMYAIYAFCRVVDDIADG-TAPEAEKRAELARWRDEIEALYArggKgPe----HPVARA 491 Rhodospirillum ...
WP_003604030  18 lPAAGSSFYTAMRLLPKERREAMYAVYAFCRVVDDVADD-GGPREVRAAELDRWRADIDALYA---GhPp----ARV-KP 88  Methylobacteriu...
WP_011253762  26 VTASGTSFARGMSILPPDRRQAMFAVYAFCRQADDIADG-DAGVADPMAALQEWHRRIDQLYE---GvAt----DALDRI 97  Gluconobacter o...
WP_011031162  22 TGQQARNFAHGIRLLPTPKRRAMSALYAFSRRVDDIGDG-VLADDVKVTRLDETRAVLARIQD---GaVeeddtDPVAVA 97  Streptomyces co...
WP_011301067  33 AVSSGSSFHAAMRILPAAQRQAMFEIYAFCRAVDDIADC-DAPHAERLAGLDAWRRDIGLCYA---GmAp----SAL-RP 103 Cupriavidus pin...
WP_011602624  92 LDDAARRFPIPLEAFIELADGVESDVHGT-TYDTFDDMVGYCRLVAGTIGRLSLGIFGteqaASD-----RSAPAIADAL 165 Frankia alni
WP_011383776  92 LHGPVLQYNLPKEDFLAVIAGCESDAQPEvTRLSMAELELYCDRVACAVGRLSIRVFG----PLR-----PKSIETANAT 162 Magnetospirillu...
WP_011085786  85 YVASVKTFGLKREDFLAIVDGMEMDVPQDiRAPDMATLDLYCDRVASAVGRLSVRVFG----LPE-----EDGIQLAYHL 155 Bradyrhizobium
WP_007178629  88 LTRHIHTFHLQREDFHAMIDGMAMDAAADiCAPDEATLDLYCDRVASAAGRLSVRIFG----MQD-----EPGRLLAHHL 158 Burkholderia sp...
WP_011240736  97 LKEPVARFHLRQEDFIAVIDGMAMDLKGPiVFPDEATLDLYCDRVASAVGRLSVYVFG----MDP-----NIGESLAYHL 167 Zymomonas mobilis
WP_011387825 492 LDGPIRRFALPREDFLAVIEGMELDAGPRvRIRDITELEQYCDWVACAVGRLSNRIFG----ADP-----ALSDDVARHT 562 Rhodospirillum ...
WP_003604030  89 LEEPMRRFDLKREDFQAVIDGMAMDAEEDiVAPSEAKLDLYCDRVASAVGRLSVRIFG----MPE-----ADGIRLAWHQ 159 Methylobacteriu...
WP_011253762  98 LIVAIHRYQLQAKDFHDVIDGMAMDCGAPiVAPDEATLDLYCDRVASAVGRLSVCVFG----DSS-----DNARRVAYHL 168 Gluconobacter o...
WP_011031162  98 LADAARRFPIPLGGLDELIDGVQMDLRGE-TYETWDDLKVYCRCVAGAIGRLSLGVFG----TEPgargaERAPEYADTL 172 Streptomyces co...
WP_011301067 104 LAQQIEAFHLRQQDFLDVIDGMTMDVVADiRAPDADTLDLYCDRVASAVGRLAVRVFG----MDE-----APGLALAHHL 174 Cupriavidus pin...
WP_011602624 166 GVALQQTNILRDVREDLLGGRIYLPAQELKAAGI-ElavD-ASGRLGGPPTALLGYLRSSAQRAEEWYDRGMVLLDLLDR 243 Frankia alni
WP_011383776 163 GMALQLTNILRDVAVDAKIGRLYLPDELLSKHGI-A---S-RDPMEVLAHPNLVAVCRELGETARGYFLASDAGQAECSR 237 Magnetospirillu...
WP_011085786 156 GRALQLTNILRDIDEDAGLGRLYLPREALLHAGI-T---S-NDPNRVIAERALPKVCLPLAQRAKVHFEKSDEIMNRNKR 230 Bradyrhizobium
WP_007178629 159 GRALQLTNILRDIDEDAGINRCYLPHELLAREGI-A---V-TSPTQIADDPSLPRVCATLAERARQHFAASDAIMDREPR 233 Burkholderia sp...
WP_011240736 168 GRALQLTNILRDIDEDAEIGRCYLPREPLEKAGI-P-----LDIEKALADPRLDKVCRDLAWQAEGHYAASDHIIHNRPK 241 Zymomonas mobilis
WP_011387825 563 GLALQLTNILRDVVEDAERDRLYLPLSRLRAHGLkT---T-KDIDAVLVHPATAKVCAELASKAAAEFAEADRAQAACDR 638 Rhodospirillum ...
WP_003604030 160 GRALQLTNILRDIDEDAERGRLYLPMEKFHKIGL-M---N-PTPQSALAHPRLGEVCAAVAAEAQEHYRQTWAIIERSPR 234 Methylobacteriu...
WP_011253762 169 GRALQLTNILRDIAEDAGRGRLYLPAELLTRFDV-P-----KNPQEALYAHGLDQVARILAQRAKDHFREARNAMRLCDS 242 Gluconobacter o...
WP_011031162 173 GLALQLTNILRDVREDAEGGRTYLPADDLAKFGC-A---AgFNGPTPPEGSDFAGLVHFEVRRARALFAEGYRLLPMLDR 248 Streptomyces co...
WP_011301067 175 GRALQLTNILRDIDEDAAIGRLYLPAPALAAAGV-QgleH-ATPMEVIAHAGIDAACAAVAREAQAHYEQADAVMARCPS 252 Cupriavidus pin...
WP_011602624 244 RSAACCGAMAGIYLRLNRRIKNEPAAVLDRRLALPGWQKAVVAARSLAG 292 Frankia alni
WP_011383776 238 ADMRPATLMKEMYREIFTRVEAEGFVPRDPPVKVSKAFKLWCILRHGLL 286 Magnetospirillum magneticum
WP_011085786 231 RTVRAPRIMSKYYHSILDLLIARGFNAPREPVRVSKVTRILILLRYAFi 279 Bradyrhizobium
WP_007178629 234 SQVRAPRIMSGVYRVLLERTLERGFDIPRTKVRKPKLRMLWIVARYAFF 282 Burkholderia sp. Ch1-1
WP_011240736 242 GYLIAPRLMAAAYSALLRKMLAQGWKNPRKKVKHNKlallwtllrlkvt 290 Zymomonas mobilis
WP_011387825 639 KTMRPAIIMKEVYRRIHAALMVRGWARLGEPVKVSRLTKLGIALRHGWL 687 Rhodospirillum rubrum
WP_003604030 235 RATKAARLMAAAYRLYLDAVVKRGWAAPRARVKPGKFPLLLVALRHGIL 283 Methylobacterium extorquens
WP_011253762 243 TAMRPARMMAASYAPILSALEKRGWKTPDIAPKVCKPWRQLRTLAAYVK 291 Gluconobacter oxydans
WP_011031162 249 RSGACVAAMAGIYRRLLDRIERDPEAVLRGRVSLPGREKAYVAVRGLSG 297 Streptomyces coelicolor
WP_011301067 253 RVVRSPRIMSQVYHCLLVRLRARGWRAPRARVRVPRAQLLWIVLRHTMv 301 Cupriavidus pinatubonensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap