1ET0


Conserved Protein Domain Family
pabC_Proteo

?
TIGR03461: pabC_Proteo 
Click on image for an interactive view with Cn3D
aminodeoxychorismate lyase
Members of this protein family are aminodeoxychorismate lyase (ADC lyase), EC 4.1.3.38, the PabC protein of PABA biosynthesis. PABA (para-aminobenzoate) is a precursor of folate, needed for de novo purine biosynthesis. This enzyme is a pyridoxal-phosphate-binding protein in the class IV aminotransferase family (pfam01063). [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid]
Statistics
?
PSSM-Id: 132501
View PSSM: TIGR03461
Aligned: 22 rows
Threshold Bit Score: 367.683
Threshold Setting Gi: 499654700
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ET0_A         3 LINGHKQESLAVSDRATQFGDGCFTTARVIDGKVSLLSAHIQRLQDACQRLMISCDFWPQLEQEMKTLAAEQQN-GVLKV 81  Escherichia coli
WP_011217939   3 LVNGTEQSCISISDRSAQYGDGSFTTVLIKQGKPLLWRLHLQRLQKNVRTFRISAPNWDEVTQQVYQQAKQYSDkGVVKV 82  Photobacterium ...
WP_005453968   3 WVNGVPQTQVSLGDRSFQYGDGCFTTIQTKNGELEYWQAHVERLEACLKTLHIPLPDWSIVSEWAHLATLKDEH-AGIKI 81  Vibrio parahaem...
WP_011574925   2 IVNGSSATQLAITDRATQYGDGCFTTMLVRDGKVEYWDAHLTRLQSTCERLLISSINWDELALHVSALAEQKTL-GVLKV 80  Pseudoalteromon...
WP_001890190  13 WVNGQRRNEVPIHDRSFQYGDGCFTTILTKEGQVQQWSSHKARLQACLDILHIPEPNWDRVWQGLQSMILPQEK-AGLKI 91  Vibrio cholerae
WP_011706108  18 LINGIPTDSVSAMDRGLAYGDGHFTTLLVKDGHPVWWPAHLARLQQASARLGLAELDWQQLGDEVAGMARDQTL-AVMKV 96  Aeromonas hydro...
WP_002811556   3 LVNGKVASSIEVADRGLQYGDGLFETIAIRDERAILYLSHLKRLEDGCRRLSIPLIARRILDEEIFKLCQGVSR-GVLKI 81  Nitrosococcus o...
WP_011072564   3 WVNGVLQASIAPTDRGLAYGDGLFATMRSSKRGILFFQQHQARLETGAARLGFDWQMSPALAEQLDTLAAQYPQ-HCIKL 81  Shewanella onei...
WP_010961243   4 LVNGRSSGCVDVRDRGFQYGDGIFTTLRLRAGKAMLLCRHFGRLADACFRLGIRYPGDEALSADLRRLGLEAAE-GVVKI 82  Methylococcus c...
WP_011328481  11 IITTVKNSTISAYDRGLNYGDGFFTTAKVVNGQVEHWSHHKARLIECAARLGFPLVDIAELEAHIAKSIAEHTL-CVLKI 89  Pseudoalteromon...
1ET0_A        82 VISRGSGGRGYSTLNSGPATRILSVTAYPAHYDRLRNEGITLALSPVRLGRNPHLAGIKHLNRLEQVLIRSHLEQTNADE 161 Escherichia coli
WP_011217939  83 VISRGEGGRGYSPAGCADTQVIISDFDWPKHYVEWQQDGIELGVCQQRLGLVPMLAGFKHLNRLEQVLLKQEVDDSGWLD 162 Photobacterium ...
WP_005453968  82 HISRGIGGRGYGTKGIEGPMVTISNFAFPVHYVDWQQNGVNLGVCETRLGIQPLLAGHKHNNRLEQVLAKAEIEHSNFAD 161 Vibrio parahaem...
WP_011574925  81 LISRGSGGRGYSPEGAKTPVYIVSQHPFPAHYQDWQRKGIELNVSSITLAKQPLLAGLKHLNRLEQVLIKHELANDAFHD 160 Pseudoalteromon...
WP_001890190  92 HISRGLGGRGYSPTQVSESIVTISAFAFPAHYQAWRDKGLAVGICQQRMGLNPLLAGHKHNNRLEQILLKREMDNAGWDD 171 Vibrio cholerae
WP_011706108  97 MLTRGSGGRGYDGTACHAPTRILSLAAYPAHYPAWQQTGIPLLVCQQRLGDAPMLAGLKTLNRLEQVLLKSELAARSGVE 176 Aeromonas hydro...
WP_002811556  82 VVTRGSGGRGYQPPSQPQPTRILSLHPWPNYPSIFMEYGITLRVCRTSLGYNPCLAGIKHLNRLEQVLARSEWENPMIPE 161 Nitrosococcus o...
WP_011072564  82 MVTRGVGGRGYAPPEQVNVTEVVSVHPIPAHYAAWQQQGIRLKTSAVQLGHQPLLAGIKHLNRLEQVLIKSLPLPQGYDD 161 Shewanella onei...
WP_010961243  83 QITRGVGGRGYRPVAEGEPTRVVSLHPAPEFPQDYYRSGVSVTLCRTPLGINTALAGVKHTNRLEQVLGRGEWAD-EFQE 161 Methylococcus c...
WP_011328481  90 VITRGEGGRGYGLPQTCNVTVLLSVLEYPQNYSRLVNEGISLNISPIKLAAQPLLAGLKTLNRLEQVLIKKALQTQPCDD 169 Pseudoalteromon...
1ET0_A       162 ALVLDSEGWVTECCAANLFWRKGNVVYTPRLDQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPV 241 Escherichia coli
WP_011217939 163 AVVLDVNGHVMEATASNIFWRCENTVYTPELDMSGVHGVMRAHVLELLDSTEYCVEFVKTSLESLLCADEIFITNALMAL 242 Photobacterium ...
WP_005453968 162 AVTLNVQNHVIETTMANLFWVKDNKVYTPSLNLSGVAGVMRRKVLEFFEANNTEVEVGDFSLVELLSSDEVWMCNSLLGV 241 Vibrio parahaem...
WP_011574925 161 CLVLDTDDVIVETSVGNIFWYCENAWHTPSLNFSGVEGVMRNQVMAYLLANQVPIHQCREGLNSIQSASEVFVCNSLMGI 240 Pseudoalteromon...
WP_001890190 172 GVCLDINGKVIETTAANIFWCRDGTMFTPCLRHAGVAGVARRQILELAQQQEIPIVIDEFTLEDLLSAEEVFITNALLEV 251 Vibrio cholerae
WP_011706108 177 GIVLNSRGFLVEGVSANLFWRRGRTVFTPDLTHCGIDGIMRRHVMAMLKQMSIELRVVEAPLESLWQAEEVWLTNTLMGI 256 Aeromonas hydro...
WP_002811556 162 GLMLDSQGHVVEGTMSNLFIVQNGLLETPDLSGCGVAGVMREFILKQAFNSGLKTIVRPLILADLRSAEEIFMCNSLIGI 241 Nitrosococcus o...
WP_011072564 162 WLVLDCMGKVIESSMANIFFIKDNQVVTPSLEHCGVAGVMREQVMLALLALQMDIDCLPFGAERLVEFDSAFITNSVLGV 241 Shewanella onei...
WP_010961243 162 GLMCDTEGFLVEGTMSNVFMVKAGRLETPLIDRCGVAGVMRRLVLEIARSRGVEVSERRIRPEELAAADEIFLTNCVIGI 241 Methylococcus c...
WP_011328481 170 VLVLDYNNNVIEASAANIIAIKQNKLFTPSLNECGIKGV---YLQSLCDKLAVDFKCV--SIADLLEADAVFICNSLMGV 244 Pseudoalteromon...
1ET0_A       242 MPVCAC-----GDVSFSSATLYEYLAP 263 Escherichia coli
WP_011217939 243 VPIKKI-----NENEFSERILLSALNK 264 Photobacterium profundum
WP_005453968 242 APVTSItasnnHKTVFPIGKLTQRLQG 268 Vibrio parahaemolyticus
WP_011574925 241 VPVSAIef-sdGHRAYYLNEKTRDLQN 266 Pseudoalteromonas atlantica
WP_001890190 252 APVTQI-----GQQRLTIGSMTRRFQE 273 Vibrio cholerae
WP_011706108 257 VPVTGI-----GETQYASPVLIRRLQE 278 Aeromonas hydrophila
WP_002811556 242 WPVRRV-----GETQYPLGPLTQHLQH 263 Nitrosococcus oceani
WP_011072564 242 VDVLAI-----DSHSFKPSPLTADLRQ 263 Shewanella oneidensis
WP_010961243 242 WPVARV-----AETNYPVGEMTTMLSR 263 Methylococcus capsulatus
WP_011328481 245 VPINRL-----EQRSFDIVHSQLLLNK 266 Pseudoalteromonas haloplanktis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap