Conserved Protein Domain Family
sulphoacet_xsc

?
TIGR03457: sulphoacet_xsc 
sulfoacetaldehyde acetyltransferase
Members of this protein family are sulfoacetaldehyde acetyltransferase, an enzyme of taurine utilization. Taurine, or 2-aminoethanesulfonate, can be used by bacteria as a source of carbon, nitrogen, and sulfur. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 132497
View PSSM: TIGR03457
Aligned: 4 rows
Threshold Bit Score: 1017.87
Threshold Setting Gi: 39932465
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAT40117  18 KMTPSEAFVETMVANGVTDMFGIMGSAFMDAMDIFAPAGIRLVPVVHEQGAGHMADGYARVSGRHGMVIGQNGPGISNCV 97  Rhodococcus opacus
Q84H44    14 EMTPSEAFVETMVANGVTEIFGIMGSAFMDAMDIFAPAGIKLIPVVHEQGAAHMADGFARVSGRTGVVIGQNGPGISNCV 93  Castellaniella defr...
Q93PS3     5 KMTPSEAMTEVLVNEGVTHVTGILGSAFMDMLDLWPTAGIEFIAVRHEQTAGHMQDAYCRITGKASVCIGQNGPGVTNLV 84  Desulfonispora thio...
Q92UW6     2 KMTTEEAFVKVLQMHGIEHAFGIIGSAMMPVSDLFPKAGIRFWDCAHETNAGMMADGFSRATGTMSMAIGQNGPGVTGFI 81  Sinorhizobium melil...
AAT40117  98 TAIAAAFWAHSPVVIVTPEAGTMGTGLGGFQEANQLPMFQEFTKYQGHVNNPKRMAEFTGRCFDRAMSEMGPTQLNIPRD 177 Rhodococcus opacus
Q84H44    94 TAIAAAYWAHTPVVIVTPEAGTTGIGLGGFQEARQLPMFQEFTKYQGHVTHPARMAEYTARCFARARDEMGPAQLNIPRD 173 Castellaniella defr...
Q93PS3    85 TCVAAANQAHTPMVVLGPSAGTPTVGWDGFQECDQVSIFRSITKQVLQVPHPSRAGDVLRTAFRIAYAERGPVYVDIPRN 164 Desulfonispora thio...
Q92UW6    82 TAMKTAYWNHTPLLMVTPQAANKTIGQGGFQEVDQMAMFEEMVCYQEEVRDPSRIPEVLNRVIEKAWRGCAPAQINIPRD 161 Sinorhizobium melil...
AAT40117 178 YFYGEIETEIPQPTRLD----RGPGGETSLNEAAELLAQAEFPVIVSGGGVVMADGVEECKALAERLGAPVVNSYLHNDS 253 Rhodococcus opacus
Q84H44   174 YFYGKIKCEIPLPQPLD----RGPGGAQSLDAAARLLAEAKFPVIISGGGVVMGDAVEECKALAERLGAPVVNSYLHNDS 249 Castellaniella defr...
Q93PS3   165 YFYGEVYEEILRPDQYRamnvRGAGDATELARATEILAAAKNPVIISGRGVVDADAFAEVKEIAHMLTAPVAMSYLHNDT 244 Desulfonispora thio...
Q92UW6   162 FWTQVIDVDLPRIVRFE----RPAGGPAAIAQAARLLSEAKFPVILNGAGVVIGNAIQESMALAEKLDAPVCCGYQHNDA 237 Sinorhizobium melil...
AAT40117 254 FPASHPLWTGPLGYQGSKAAMKLISQADVVLALGTRLGPFGTLPQHGMDYWPKNAKIIQIDADHKMLGLVKKISVGICGD 333 Rhodococcus opacus
Q84H44   250 FPASHPLWCGPLGYQGSKAAMKLLADADVVLALGTRLGPFGTLPQHGLDYWPKNARIIQVDADSKMLGLVKKITVGVCGD 329 Castellaniella defr...
Q93PS3   245 YPADDELWVGPIGYMGAKSAMYSLQDADVILAIGSRLSVFGTLPQYDINYFPENAKIIQIEVNPKQIGRRHPVTVPIIGD 324 Desulfonispora thio...
Q92UW6   238 FPGSHRLSVGPLGYNGSKAAMELISKADVVLALGTRLNPFSTLPGYGIDYWPKDAAIIQVDINADRIGLTKKVTVGICGD 317 Sinorhizobium melil...
AAT40117 334 AKAAAVALTERLEGKalVCDAN-RAARGEKIDAEKAAWEKELDEWTHERDPFSLDMIAEQEGEEGNWLHPRQVLRELEKA 412 Rhodococcus opacus
Q84H44   330 AKASAAEISRRIDGMklACDAN-KAERAARIQAEKDAWEQELTDWTHERDPFSLDMIEEQSKEEGNWLHPRQVLRELEKA 408 Castellaniella defr...
Q93PS3   325 AKLATAELIKLLKAK---GDVKpNAERLAKIQERRNDWFKEIEEMA---------------MMPGNPINPRRVLFEVAKL 386 Desulfonispora thio...
Q92UW6   318 AKQVAQQILQQLAPA--AGDAS-REERKALVHQTRSAWLQQLSSMDHEDDDPGTEWNVGARQREPDRMSPRQVWRAIQAV 394 Sinorhizobium melil...
AAT40117 413 MPEDVMVSTDIGNINSVANSYLRFEKPRSFLAPMSFGNCGYALPTVIGAKAAAPERPAIAYAGDGAWGMSLGEIMTAVRH 492 Rhodococcus opacus
Q84H44   409 MPEDVMVSTDIGNINSVANSYLRFEKPRSFFAAMSWGNCGYAFPTIIGAKVAAPHRPAVSYAGDGAWGMSMSEIMTCVRH 488 Castellaniella defr...
Q93PS3   387 MPEDAILTTDIGNVASTANSYFKFTKPKKHIAALTFGNTGFAYQAGLGAQMAEPDSPVVAIVGDGAWGQSLHEISTAVQY 466 Desulfonispora thio...
Q92UW6   395 LPKEAIISTDIGNNCAIGNAYPSFEQGRKYLAPGMFGPCGYGFPSIVGAKIGCPDVPVVGFAGDGAFGISMNEMTSIGRE 474 Sinorhizobium melil...
AAT40117 493 DIP-VTAVVFHNRQWGAEKKNQVDFYNRRFVAGELESE-SFAGIAQAMGAEGIVVDKLEEVGPALQRAVAAQmNEGKTTV 570 Rhodococcus opacus
Q84H44   489 DIP-VTAVVFHNRQWGAEKKNQVDFYNRRFVAGELESE-SFAGIARAMGAEGVVVDRIEDVGPALKKAIDAQmNDRKTTV 566 Castellaniella defr...
Q93PS3   467 KLP-VIACVFRNMAWCAEKKNQIDFYNNRFVGTEIPNPiSFIPAAEAFGAKGIRVEKPEDIADAFKQGLAWR-AEGHPVV 544 Desulfonispora thio...
Q92UW6   475 GWPaITMVIFRNYQWGAEKRNTTLWYDNNFVGTELNPNlSYAKVADGCGLKGVTVDTPAALTEALAKAIEDQ-AKGITTF 553 Sinorhizobium melil...
AAT40117 571 IEIMCTRE-LGDPFRRDALSKPVRL--LDKY 598 Rhodococcus opacus
Q84H44   567 IEIMCTRE-LGDPFRRDALSKPVRL--LEKY 594 Castellaniella defragrans
Q93PS3   545 LEFVVDGTiLAPPFRKDALALPTRY--LPKY 573 Desulfonispora thiosulfatigenes
Q92UW6   554 VEVVLNQE-LGEPFRRDAMKKPVAVagIDRA 583 Sinorhizobium meliloti 1021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap