Conserved Protein Domain Family
mycothione_red

?
TIGR03452: mycothione_red 
mycothione reductase
Mycothiol, a glutathione analog in Mycobacterium tuberculosis and related species, can form a disulfide-linked dimer called mycothione. This enzyme can reduce mycothione to regenerate two mycothiol molecules. The enzyme shows some sequence similarity to glutathione-disulfide reductase, trypanothione-disulfide reductase, and dihydrolipoamide dehydrogenase. The characterized protein from M. tuberculosis, a homodimer, has FAD as a cofactor, one per monomer, and uses NADPH as a substrate.
Statistics
?
PSSM-Id: 132493
View PSSM: TIGR03452
Aligned: 8 rows
Threshold Bit Score: 820.926
Threshold Setting Gi: 499917716
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011728470   2 EHYDLAIIGTGSGNSIVDDRYAGKKVAICEQGTFGGTCLNVGCIPTKMFVYAAEVAHSVRTSARYGVDAHIDKVRWPDIV 81  Mycobacterium s...
WP_010935104   7 RHYDLIIVGSGSGNSIPGPEFDDKSIAIVEKGKFGGTCLNVGCIPTKMFVYASEIAQVIVDSERFGISASIDSVQWPDIV 86  Corynebacterium...
WP_011774631  17 RHYDLIIIGTGSGNSIPGPEFEDQSIAIIEEGSFGGTCLNAGCIPSKMYVYTADTALQTVESGRLGLHAEVNSVDWPGIV 96  Arthrobacter au...
WP_011014816   9 KHYDLIIIGTGSGNSIPGPEFDDKSIAIVEKGAFGGTCLNVGCIPTKMYVYAADIAQEIQESARLGIDATVNSVDWPSIV 88  Corynebacterium...
WP_003414557   2 ETYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDVV 81  Mycobacterium t...
WP_011559465   2 AHFDIAIIGTGSGNTILDERYVDKRVAVCEQGVFGGTCLNVGCIPTKMFVYSAGIAQNVGDSARFGIDARIDGVRWSDIV 81  Mycobacterium
WP_011273688   2 PDFDLIIVGTGSGNSLPSPANEHQRIAIVEKGTFGGTCINVGCIPTKMFVHTADVARSFSEASRLSLTGELQHVDWKDIQ 81  Corynebacterium...
WP_011598450   2 THFDLAIIGSGSGNSLPDERFADKTIAILEEGTFGGTCLNVGCIPTKMFVYAAEVARTVGNSAKYGVDAELEGVRWPDIV 81  Rhodococcus jostii
WP_011728470  82 ERVFG-RIDPIAAGGEDYRRSD--PNITVYSSHTRFGpktddGRYTLRTESGEE---FTSDQVVIAAGSRTYIPPAVVDC 155 Mycobacterium s...
WP_010935104  87 ERVFAhRIDPIAASGEEYRRGDktPNIDVYDQHARFI-----APKTLQIGDGENapiISGDTIVIATGSRPFIPSYIEES 161 Corynebacterium...
WP_011774631  97 SRIFEdRIDPDSAAGEEYRRGPrtPNIDVYDQHAVFV-----GERTLRTGQGSQqrtISGDRIVIAAGSRPAVPDVISAS 171 Arthrobacter au...
WP_011014816  89 SRVFDkRIDLIAQGGEAYRRGPetPNIDVYDMHASFV-----DSKTISTGIAGQeqlISGTDIVIATGSRPYIPEAIAES 163 Corynebacterium...
WP_003414557  82 SRVFG-RIDPIALSGEDYRRCA--PNIDVYRTHTRFGpvqadGRYLLRTDAGEE---FTAEQVVIAAGSRPVIPPAILAS 155 Mycobacterium t...
WP_011559465  82 SRVFG-RIDPLATGGEHYRRAt--PNVEVFASHTRFAdvlrdGRYRLRTEDGDE---FTADQVVIAAGSRATVPPAISDC 155 Mycobacterium
WP_011273688  82 RRVFAdRIDPISESGADYRAGDetPNITLFEGTARFV-----GPRTLQIGDGPT---ITGANIVLATGGRPRIHPALAD- 152 Corynebacterium...
WP_011598450  82 KRVFG-RIDPISAGGERYRAEDs-PNTTLFRGHATFV-----GPRTLDTGTGEV---ITADQVVIAAGSRPIIPDVVRES 151 Rhodococcus jostii
WP_011728470 156 GVKYHTSDDIMRIPELPTDLVIIGGGFVSAEFAHVFSALGVHVTIVVRGDGLLTHCDETICHRFNEIAATKWDIRTHENV 235 Mycobacterium s...
WP_010935104 162 KVTYYTNETIMRMPDLPRSMVVLGGGYIAMEFAHVFSALGVNVTVVNRSPQLLRVLDEDISHRFTEITKTKMDCRLGRTV 241 Corynebacterium...
WP_011774631 172 GVRYHTNEDIMRLPQLPKSLVIIGGGYIAMEFAHVFDALGTDVTIIARST-LLRHLDEDLLDPYNNLAAKRFDIRSGRTT 250 Arthrobacter au...
WP_011014816 164 GARYYTNEDIMRLAQQPESLVIVGGGFIALEFAHVFEALGTKVTILNRSDVLLREADADISAKILELSKKRFDVRLSTAV 243 Corynebacterium...
WP_003414557 156 GVDYHTSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNV 235 Mycobacterium t...
WP_011559465 156 GVQYHTSDTIMRLPELPEHIIIAGGGYVAAEFAHIFSSLGSRVTIVIRGTAMLAHADDTVCERFTDIAGKKWEIRSRRNI 235 Mycobacterium
WP_011273688 153 -VRYRTNEDIMRLDELPKSLIVVGGGIVAVEFAAMFSGLGTQVTLINRSEKLLRKLDADISDTFTTQAKQQWTNHLGCNI 231 Corynebacterium...
WP_011598450 152 GVRYYTNDDIMRLPELPERMVIIGAGYIAAEFAHVFSALGTRVSLIARSSHLLRHLDEDVSRRFTDLAQKKWDVHRGSTV 231 Rhodococcus jostii
WP_011728470 236 IGSHQDGDR-IVLELDDGKTVAADTLLVATGRVPNGDLLDAELAGVEVdEDGRVIVDQYQR-TTARGVFALGDVSSDYQL 313 Mycobacterium s...
WP_010935104 242 SSVDQDSNG-VTLTLDDGSTATGEVLLVATGRIPNGDQMNLDSAGIDM-DGKRIKVDDFGR-TTADGVWALGDVSSPYQL 318 Corynebacterium...
WP_011774631 251 TSAEQTDRG-ITVTLDDGSSATGEVLLVATGRIPNGDLLDLPSGGIETiGAGRIKVDEYGRsTSAAGVWALGDVSSPYML 329 Arthrobacter au...
WP_011014816 244 TAVHNKADGgVKISTDTGDDIEADILLVATGRTPNGNQMNLDAAGIEM-NGRSIKVDEFGR-TSVEGVWALGDVSSPYKL 321 Corynebacterium...
WP_003414557 236 VDGQQRGSG-VALRLDDGCTINADLLLVATGRVSNADLLDAEQAGVDV-EDGRVIVDEYQR-TSARGVFALGDVSSPYLL 312 Mycobacterium t...
WP_011559465 236 IGGSTDESG-VTLNLDDGSALHGDVLLVATGRVPNGDRLDAHLAGVAV-EDGLVRVDEYQR-TTARNVFALGDVCSPYQL 312 Mycobacterium
WP_011273688 232 TAAEETDDGqITLTLDDGTTVTAEEVLVAMGRVNNSDTLDCETGGVKTrKDGLIEVDEYGR-TSADGVWALGDACNDFEL 310 Corynebacterium...
WP_011598450 232 AAVRRDGDG-VVVELEDGTVVSGDVLLVATGRQSNGDAIGAAAGGIDLdDEGRVVVDDYQR-TSAEGVFALGDVSSPYQL 309 Rhodococcus jostii
WP_011728470 314 KHVANHEARVVKENLLRDwd-dtASLVASDHRFVPSAVFTDPQVATVGLTEAEARAAGHDIVVKVQNYGDTAYGWAMEDT 392 Mycobacterium s...
WP_010935104 319 KHVANAEMRAVKHNLLHP-----EDLKSMPHQHVPAGVFTHPQIATVGLTEQEARDAGYSITVKIQNYGDVAYGWAMEDT 393 Corynebacterium...
WP_011774631 330 KHVANAEMRAVRHNLLNP-----DNMQKMPHDHVPAAIFTHPQIATVGMTESQARERGHNVTTKVQSYGDVAYGWAMEDT 404 Arthrobacter au...
WP_011014816 322 KHVANAEMRAIKHNLANP-----NDLQKMPHDFVPSAVFTNPQISQVGMTEQEAREAGLDITVKIQNYSDVAYGWAMEDK 396 Corynebacterium...
WP_003414557 313 KHVANHEARVVQHNLLCDwe-dtQSMIVTDHRYVPAAVFTDPQIAAVGLTENQAVAKGLDISVKIQDYGDVAYGWAMEDT 391 Mycobacterium t...
WP_011559465 313 KHVANHEARVVKNNLLVDwd-dtDALMPANHSNVPSAVFTEPQIACVGLTENEARARGHRIRTKVQDYGDVAYGWAMEDT 391 Mycobacterium
WP_011273688 311 KHVANAEARVVAHNLAHP-----NDLRKFNHDVVPSGVFTHPQIGVVGLTEQEARETGRPLTVKIQKYSDVAYGWAMEDT 385 Corynebacterium...
WP_011598450 310 KHVANHEARVVQHNLLQDawtdtSGLRVSDHRFVPAAVFTDPQIAHVGLTEAEAREAGWDITVKVQAYGDVAYGWAMEDD 389 Rhodococcus jostii
WP_011728470 393 TGIAKLIGERGTGKLLGAHILGHQASSIIQPLIQAMSLGQTAQEIARGQYWIHPALPEVIENALLGL 459 Mycobacterium smegmatis
WP_010935104 394 QHFAKLIADKKTGRLLGAHFIGPQASTLIQQLITVMAFDLDVREVATKQYWIHPALPELTENALLGL 460 Corynebacterium diphtheriae
WP_011774631 405 TSICKLIADQDTGKLLGAHYMGPQASTLVQQMITVLAFDLDVRQFAAKQYWIHPALPEVTENALLGL 471 Arthrobacter aurescens
WP_011014816 397 DGFVKLIADKDTGKLVGAHIIGAQASTLIQQLITVMAFGIDAREAATKQYWIHPALPEVIENALLGL 463 Corynebacterium glutamicum
WP_003414557 392 SGIVKLITERGSGRLLGAHIMGYQASSLIQPLIQAMSFGLTAAEMARGQYWIHPALPEVVENALLGL 458 Mycobacterium tuberculosis c...
WP_011559465 392 EAFAKLIVDDDTGLLLGAHIMGHQASSIIQPLVQAMAFGLPAQDMARGQYWIHPALPEVVENALLAL 458 Mycobacterium
WP_011273688 386 TGFCKVIADRSTGEILGAHIIGPEASSLIQCFVTAMTFGISARDFAEKQYWPHPALTELVENALLGL 452 Corynebacterium jeikeium
WP_011598450 390 EGLCKVIAERGTGRLLGAHVIGAQAPTVIQPLIQAMSFGLTAQQMARGQYWIHPALPEVVENALLGL 456 Rhodococcus jostii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap