Conserved Protein Domain Family
mycoS_dep_FDH

?
TIGR03451: mycoS_dep_FDH 
S-(hydroxymethyl)mycothiol dehydrogenase
Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 132492
View PSSM: TIGR03451
Aligned: 8 rows
Threshold Bit Score: 614.888
Threshold Setting Gi: 499755157
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P80094         3 TVRGVIARSKGAPVELTDIVIPDPGPSEVTALIATCAVCHTDLTYREGGINDEFPFLLGHEAAGTVESVGEGVDSVQPGD 82  Amycolatopsis m...
EQM22989       7 TVRGVIARQKGEPVELVNIVVPDPGPGEAVVDVTACGVCHTDLTYREGGINDEYPFLLGHEAAGIIEAVGPGVTAVEPGD 86  Mycobacterium t...
WP_011027326   4 EVRGVIAPGKDEPVRIETIVVPDPGPGEAVVKIQACGVCHTDLHYKQGGINDEFPFLLGHEAAGVVESVGAGVTDVAPGD 83  Streptomyces
WP_010988350   6 EVRAVVAVKKGAPVEVQTIVVPDPGPGEVLVAVQACGVCHTDLHYREGAITDDFPFLLGHEAAGTVEAVGAGVTDLAPGD 85  Streptomyces av...
WP_006770184   4 TVPGIIARSKGAPVEKVNVVVPDPGANDVIVDIQACGVCHTDLAYRDGDISDEFPYLLGHEAAGVVSVVGENVTHVEVGD 83  Corynebacterium...
WP_011774998  27 AVKGVVVRSKGAPATLETILVPEPGPGEALVDILTSGVCHTDLHYKLGGISDDFPFLLGHEATGVVSAVGPDVTDVAPGD 106 Arthrobacter
WP_011273268   4 TVKAVISRAKNEPVELTDIVIPEPGENDVIVRIQACGVCHTDLAYRDGGIADNYPFLLGHEAAGVVEQVGDRVTHVEVGD 83  Corynebacterium...
WP_011435891   5 TVEAVVAREKGAAVSLEQIVVPDPGPGEARVRVRACGVCHTDLHYREGAINDDYPFLLGHEAAGTVESVGEGVVGLAPGD 84  Frankia
P80094        83 YVVLNWRAVCGQCRACKRGRPQYCFSTFNATQKMTLTD-GTELTPALGIGAFADKTLVHAGQCTKVDPAADPAVAGLLGC 161 Amycolatopsis m...
EQM22989      87 FVILNWRAVCGQCRACKRGRPRYCFDTFNAEQKMTLTD-GTELTAALGIGAFADKTLVHSGQCTKVDPAADPAVAGLLGC 165 Mycobacterium t...
WP_011027326  84 FVILNWRAVCGKCRACRRGRPWYCFDTHNAEQRMTLAStGQELSPALGIGAFAEKTLVAAGQCTKVDPAVPAEVAGLLGC 163 Streptomyces
WP_010988350  86 YVVLAWRAPCGSCRSCRRGRPWYCFDSRNATQPMTLLD-GTPLSNALGIGAFAEKTLVAAGQAVKIDPAARPEAAGLIGC 164 Streptomyces av...
WP_006770184  84 FVVLNWRAVCGECRACKKGEPKYCFNTHNASKKMTLED-GTELSPALGIGAFIEKTLVHEGQCTKVNPDEDPAAAGLLGC 162 Corynebacterium...
WP_011774998 107 RVVLNWRAVCGNCRACNRGQAQYCFNTHNATQKMTLED-GTELSPALGIGAFIEKTLVAAGQCTKVDPDADAAAVGLLGC 185 Arthrobacter
WP_011273268  84 YVVLNWRAVCGQCRACKKGEPKYCFDTHNASKKMTLTD-GTELEAALGIGAFAEKTLVHEGQCTKVDSEADPAVAGLLGC 162 Corynebacterium...
WP_011435891  85 YVVLAWRAPCGTCRACRRGMAWYCFDSRNARNPMTLAD-GTPLAPALGIGAFTPLTLVAAGQCVPVDPAARPEAAGLIGC 163 Frankia
P80094       162 GVMAGLGAAVNTGAVSRGDSVAVIGCGAVGDAVIAGARLAGANKIIAVDRDAKKLEWAT-ELGATHTVNATE-------T 233 Amycolatopsis m...
EQM22989     166 GVMAGLGAAINTGGVTRDDTVAVIGCGGVGDAAIAGAALVGAKRIIAVDTDDTKLDWAR-TFGATHTVNARE-------V 237 Mycobacterium t...
WP_011027326 164 GVMAGIGAAINTGNVGRGDTVAVIGCGGVGDAAIAGSYLAGASKVIAVDIDDRKLETAR-TMGATHTVNSRG-------T 235 Streptomyces
WP_010988350 165 GVMAGYGAAVNTGKVGRGDTVAVIGCGGVGNAAIAGACLNGAMKVIAVDIDDKKLDQAE-KFGATHTVNSRG-------T 236 Streptomyces av...
WP_006770184 163 GIMAGLGAAVNTADIQLGESVAVFGLGGVGMAAVAGAKLAGASKIIAVDIDERKLEWAR-EFGATDVINSSGlsgegeeS 241 Corynebacterium...
WP_011774998 186 GVMAGLGAALNTGGVKRGDSVAVIGCGGVGVAAIAGAALAGATTIIAVDIDAKKLERAK-ELGATHTVDSSA-------G 257 Arthrobacter
WP_011273268 163 GVMAGLGAAVNTGEVKRGESIAVIGVGGVGMAAIAGAAVAGATKIIAIDISDAKLARAKeEFGATHTINSSGls----dD 238 Corynebacterium...
WP_011435891 164 GVMAGFGAAVNTGRVTRGETVAVIGCGGVGGAAIAGASIAGARKIIAVDVDDRKLTWAR-RFGATDVVNATA-------D 235 Frankia
P80094       234 DVVEAVQALTGGFGADVVIDAVGRPETWKQAFYARDLAGTVVLVGVPTPDMRLEMPLLDFFSRGGALKSSWYGDCLPERD 313 Amycolatopsis m...
EQM22989     238 DVVQAIGGLTDGFGADVVIDAVGRPETYQQAFYARDLAGTVVLVGVPTPDMRLDMPLVDFFSHGGALKSSWYGDCLPESD 317 Mycobacterium t...
WP_011027326 236 DPVEAIRELTGGFGADVVIEAVGRPETYRQAFYARDLAGTVVLVGVPTPEMKLELPLLDVFGRGGSLKSSWYGDCLPSRD 315 Streptomyces
WP_010988350 237 DPVEAVRALTDGFGVDIAIDAVGRPETYKQAFYMRDHAGTLVQVGVPDPEMKIDLPLIDLFSRGGALKSSWYGDCLPSRD 316 Streptomyces av...
WP_006770184 242 EVVAKIRELTGGFGTDVTIDAVGIMPTWQQAFYSRDHAGRMVMVGVPNLTSHIDIPAIDFYGRGGSLRPAWYGDCLPERD 321 Corynebacterium...
WP_011774998 258 DPVEEIRALTGGFGADVVIDAVGRPETYKQAFYARDLAGTVVLVGVPTPEMTLELPLLDVFGRGGSLKSSWYGDCLPSRD 337 Arthrobacter
WP_011273268 239 ELVEKVQEINGGFGVDVAVDAVGVPQTYKQAFYVRDLAGRVVLVGVPTPDMTLELPFLDVFSHGGALKSSWYGDCLPERD 318 Corynebacterium...
WP_011435891 236 DPVAAIRALTDGFGADVVIDAVGRPETYRQAFDARDLAGRLVLVGVPDPTMTVELPLAEVFGRGGHLSSSWYGDSLPSRD 315 Frankia
P80094       314 FPVLIDLHLQGRLPLDKFVTERISLDDVEKAFHTMHAGEVLRSVVVW 360 Amycolatopsis methanolica
EQM22989     318 FPTLIDLYLQGRLPLQRFVSERIGLEDVEEAFHKMHGGKVLRSVVML 364 Mycobacterium tuberculosis FJ05194
WP_011027326 316 FPMLVDLHLQGRLDLGKFVTETIRLDEVEQAFDRMHAGDVLRSVVVL 362 Streptomyces
WP_010988350 317 FPFLIDQYLYGLLDLNAFVSETISLEQVEEAFAKMHRGEVLRSVVVL 363 Streptomyces avermitilis
WP_006770184 322 FPAYVELHLQGRFPLDKFVSERIGLDDVEEAFNTMKAGDVLRSVVEL 368 Corynebacterium efficiens
WP_011774998 338 FPMLVDLYKQGKLDLDAFVTERITINQVEDAFDKMHQGAVLRSVVEL 384 Arthrobacter
WP_011273268 319 FPMYVDLYQEGRFPLDRFVDDRISIDGVEDAFEKMKQGKVLRSVVEF 365 Corynebacterium jeikeium
WP_011435891 316 FPILIDLYRRGRLDLDAFVTETIGIGDVEEAFTRMQRGDVLRSVVIL 362 Frankia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap