
Conserved Protein Domain Family

TIGR03450: mycothiol_INO1 
Click on image for an interactive view with Cn3D
inositol 1-phosphate synthase, Actinobacterial type
This enzyme, inositol 1-phosphate synthase as found in Actinobacteria, produces an essential precursor for several different products, including mycothiol, which is a glutathione analog, and phosphatidylinositol, which is a phospholipid.
PSSM-Id: 132491
Aligned: 5 rows
Threshold Bit Score: 713.628
Threshold Setting Gi: 20149886
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1GR0_A       331 RGIGGPVIPASAYLMKSPPEQLPDDIARAQLEEFI 365 Mycobacterium tuberculosis H37Rv
WP_005292489 326 RGVAGPVEAASSYLMKSPPTQLPDDVARAQLEEFI 360 Corynebacterium jeikeium
WP_010985721 320 RGIGGPILSASSYFMKSPPVQYFDDEAYANVEKFI 354 Streptomyces avermitilis
WP_003400492 331 RGIGGPVIPASAYLMKSPPEQLPDDIARAQLEEFI 365 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap