1GR0


Conserved Protein Domain Family
mycothiol_INO1

?
TIGR03450: mycothiol_INO1 
Click on image for an interactive view with Cn3D
inositol 1-phosphate synthase, Actinobacterial type
This enzyme, inositol 1-phosphate synthase as found in Actinobacteria, produces an essential precursor for several different products, including mycothiol, which is a glutathione analog, and phosphatidylinositol, which is a phospholipid.
Statistics
?
PSSM-Id: 132491
View PSSM: TIGR03450
Aligned: 5 rows
Threshold Bit Score: 713.628
Threshold Setting Gi: 20149886
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GR0_A        16 VRVAIVGVGNCASSLVQGVEYYYNADDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIAD 95  Mycobacterium t...
WP_005292489   6 CNIAIVGLGNCASSLIQGIHLYSDAAATENVPGLMHTQFGPYSVGDVHVTAAFDVDADKVGKDVSEAIDAGMNCTIKIAD 85  Corynebacterium...
WP_010985721   4 VRVAIVGVGNCAASLVQGVEYYKDADPASKVPGLMHVQFGEYHVGDVEFVAAFDVDAKKVGLDLSDAIGASENNTIKICD 83  Streptomyces av...
WP_003400492  16 VRVAIVGVGNCASSLVQGVEYYYNADDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIAD 95  Mycobacterium t...
WP_003855107   6 IRVAIAGVGNCATSLIQGVEYYRNADPSETVPGLMHVKFGDYHVGDIEFVAAFDVDAEKVGIDLADATEASQNCTIKIAD 85  Corynebacterium
1GR0_A        96 VAPTNVIVQRGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAIDAGVAFVNALPVF 175 Mycobacterium t...
WP_005292489  86 VPHTGVTVQRGHTFDGLGRHYQESITESDAEPVDVPQALRDANVDVLVSYLPVGSEEADRFYAQCAIDAGCAFVNALPVF 165 Corynebacterium...
WP_010985721  84 VPNKGITVQRGHTLDGLGKYYRQTIEESAEAPVDVVQILKDKQVDVLVCYLPVGSEDAAKFYAQCAIDAKVAFVNALPVF 163 Streptomyces av...
WP_003400492  96 VAPTNVIVQRGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAIDAGVAFVNALPVF 175 Mycobacterium t...
WP_003855107  86 VPQTGINVLRGPTLDGLGDHYRATIDESTAEPVDVVQALIDAKADVLVSYLPVGSEEADKFYAQAAIDAGCAFVNALPVF 165 Corynebacterium
1GR0_A       176 IASDPVWAKKFTDARVPIVGDDIKSQVGATITHRVLAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERLESKKISKTQA 255 Mycobacterium t...
WP_005292489 166 IASDPEWAEKFRAAGLPIVGDDIKSQVGATITHRVLARLFEERGVRLERTMQLNVGGNMDFKNMLDRDRLESKKISKTQA 245 Corynebacterium...
WP_010985721 164 IAGTKEWADKFTEAGVPIVGDDIKSQVGATITHRVMAKLFEDRGVRLERTMQLNVGGNMDFKNMLERDRLESKKISKTQA 243 Streptomyces av...
WP_003400492 176 IASDPVWAKKFTDAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERLESKKISKTQA 255 Mycobacterium t...
WP_003855107 166 IASDPEWAKKFTDAGIPIVGDDIKSQIGATITHRVLARLFEERGVRVDRTMQLNVGGNMDFKNMLDRNRLESKKVSKTQA 245 Corynebacterium
1GR0_A       256 VTSNL-KREFK----TKDVHIGPSDHVGWLDDRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKD 330 Mycobacterium t...
WP_005292489 246 VTSNLtESPLAgkvhDRNVHIGPSDYVEWLDDRKWAYVRLEGSAFGEVPLNLEYKLEVWDSPNSAGIIIDAVRAAKIALD 325 Corynebacterium...
WP_010985721 244 VTSQIpDRDLG----EKNVHIGPSDYVAWLDDRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDALRAAKIAKD 319 Streptomyces av...
WP_003400492 256 VTSNL-KREFK----TKDVHIGPSDHVGWLDDRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKD 330 Mycobacterium t...
WP_003855107 246 VTSNIpDGPLSgkveDRNVHIGPSDHVQWLDDRKWAYVRLEGTAFGGVPLNLEYKLEVWDSPNSAGIIIDAVRAAKIALD 325 Corynebacterium
1GR0_A       331 RGIGGPVIPASAYLMKSPPEQLPDDIARAQLEEFI 365 Mycobacterium tuberculosis H37Rv
WP_005292489 326 RGVAGPVEAASSYLMKSPPTQLPDDVARAQLEEFI 360 Corynebacterium jeikeium
WP_010985721 320 RGIGGPILSASSYFMKSPPVQYFDDEAYANVEKFI 354 Streptomyces avermitilis
WP_003400492 331 RGIGGPVIPASAYLMKSPPEQLPDDIARAQLEEFI 365 Mycobacterium tuberculosis complex
WP_003855107 326 RGIGGPIMPASSYLMKSPPEQLPDDVARERLEAFI 360 Corynebacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap