3C4Q


Conserved Protein Domain Family
mycothiol_MshA

?
TIGR03449: mycothiol_MshA 
Click on image for an interactive view with Cn3D
D-inositol-3-phosphate glycosyltransferase
Members of this protein family, found exclusively in the Actinobacteria, are MshA, the glycosyltransferase of mycothiol biosynthesis. Mycothiol replaces glutathione in these species.
Statistics
?
PSSM-Id: 132490
View PSSM: TIGR03449
Aligned: 11 rows
Threshold Bit Score: 661.819
Threshold Setting Gi: 499754185
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C4Q_A         3 VAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELP 82  Corynebacterium...
WP_011265551   5 VAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELP 84  Corynebacterium...
WP_006770340   3 VAMISMHTSPLQQPGVGDSGGMNVYILSTGTELARQGVEVDIFTRATRPSQGEVVQVAPNLRVINIVAGPYEGLAKEELS 82  Corynebacterium...
WP_005251940  13 VAVLSVHTSPLAQPGTGDAGGMNVYVLQSAIQMARRGVEVEIFTRATSSADAPVQEAAPGVLVRNVVAGPFEGLDKQDLP 92  Rhodococcus opacus
WP_005292156   3 VAMISMHTSPLEQPGTGDAGGMNVYVKNIAEQLERRGVIVDVFTRATRPLQGEVVNVRPGLRVINCVAGPYEGLSKEELP 82  Corynebacterium...
WP_011211726  15 IAVLSVHTSPLAQPGTGDAGGMNVYVLRTAVELAQRGIEVEIFTRATASHIPPVQEAAPGVLVRNVVAGPFEGLDKQDLP 94  Nocardia farcinica
WP_010934263   6 IAMISIHTSPLQQPGSGDAGGMNVYIISIARELARRGVDVDIYTRATRPSQGDVVEVESGLRVINIVAGPYEGLSKEELP 85  Corynebacterium...
WP_016189367   6 IAAISLHTSPLDQPGTGDAGGMNVYIVEVAKRLAERGIAVDIFTRATSFEQPPEVELAPGVTVRNIAAGPYGTLDKTALI 85  Thermobifida fusca
WP_003917307  44 VALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVAPGVLVRNVVAGPFEGLDKYDLP 123 Mycobacterium t...
WP_011434919  24 VAMLSMHTSPMEQPGTGDAGGLNVYVVELSRQLAALGVEVEVFTRAVSSKLPTSAELLPGVTVRHVDAGPFEEIHREDLP 103 Frankia
WP_010985435  47 VAMLSVHTSPLHQPGTGDAGGMNVYIVELAQRLAAINIEVEIFTRATTAALRPTVELSPGVLVRHVDAGPYEGLAKEDLP 126 Streptomyces av...
3C4Q_A        83 TQLAAFTGGML-SFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQL 161 Corynebacterium...
WP_011265551  85 TQLAAFTGGML-SFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQL 163 Corynebacterium...
WP_006770340  83 TQLAAFAGGVL-EFTRRGGIEYDLIHSHYWLSGQVGWLMRDLWRIPLVHTAHTLAAVKNSYRADEDTPESEARRICEQQL 161 Corynebacterium...
WP_005251940  93 TQLCAFVAGVLrEEARHEPGYYNLVHSHYWLSGQVGWLARDRWGVPLVHTAHTLAAVKNLSLADGDTPEPAARQIGEQQV 172 Rhodococcus opacus
WP_005292156  83 TQLAAFTGSIL-AFCREEGVSYDLIHSHYWLSGQVGWLLRDLWQVPWVHTAHTLAAVKNNSLADGDSREPESRRICEQQI 161 Corynebacterium...
WP_011211726  95 TQLCPFTAEVLrQEARQLPGYYDLVHSHYWLSGQVGWLTRDRWRVPLVHTAHTLAAVKNAALAEGDAPEPVSREIGEKQI 174 Nocardia farcinica
WP_010934263  86 TQLAAFAGGVV-QFAKCHHMRYDVIHSHYWLSGQVGWLLRDLWNIPLVHTAHTLAAVKNAHRSAGDTEESEARRICEQQL 164 Corynebacterium...
WP_016189367  86 NYLCPFVHGMLrAEAEHLGGSYDLVHTHYWLSGQAGWPVAREWGVPLVHSMHTMARVKNMSLAEGDTPEPEERVRGEDAL 165 Thermobifida fusca
WP_003917307 124 TQLCAFAAGVLrAEAVHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQV 203 Mycobacterium t...
WP_011434919 104 AWLCAFTAALLrAEAGHEPGWFDVIHSHYWLSGQVGLAVAQRWGIPLVHTSHTLAKIKNGALAVGDRPEPPGRLLGEQEV 183 Frankia
WP_010985435 127 AQLCAFTHGVMqAWAGHRPGYYDLVHSHYWLSGHVGWLAAQRWGTPLVHAMHTMAKVKNAALAEGDTPEPAARVIGEMQI 206 Streptomyces av...
3C4Q_A       162 VDNADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGnD-RATERSRreLGIPLHTKVVAFVGRLQPFKGPQV 240 Corynebacterium...
WP_011265551 164 VDNADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGnD-RATERSRreLGIPLHTKVVAFVGRLQPFKGPQV 242 Corynebacterium...
WP_006770340 162 VDNADVLAVNTQEELADLVHHYDADPDRISVVSPGADIALYTPGnD-RATERSRreLGVPLHAKVVAFVGRLQPFKGPQV 240 Corynebacterium...
WP_005251940 173 VAESDRLVANTTEESDQLVRHYGADPNRIDVVAPGADLTRYRPG-D-RAAARAK--LGLDPRETVVTFVGRIQPLKAPDV 248 Rhodococcus opacus
WP_005292156 162 VDNADLLIVNTDQEVQDLIEGYDATTCAIRVVPPGADVDRFTPGsD-RATERSRreLGIPFRTKVIGFVGRLQRLKGPQV 240 Corynebacterium...
WP_011211726 175 IAEADRMVANTAEEARQLVELYGADRDRIDVVPPGADLTRYRPG-D-RAAARAE--LGLAPGEPIVAFVGRIQPLKAPDV 250 Nocardia farcinica
WP_010934263 165 VDNADILVVNTPEETNDLVRHYDANPDSVAVIAPGANVELFTPG-TqRNTEQSRrcLGIPLHTKVMAFVGRLQQFKGPEV 243 Corynebacterium...
WP_016189367 166 VALADRLIANTDDEAAQLINYYGASPSRVSTVFPGVDLTTFTPG-S-RAESLRR--LGLPEDTILLLFVGRVQRLKAPDV 241 Thermobifida fusca
WP_003917307 204 VDEADRLIVNTDDEARQVISLHGADPARIDVVHPGVDLDVFRPG-D-RRAARAA--LGLPVDERVVAFVGRIQPLKAPDI 279 Mycobacterium t...
WP_011434919 184 IGGATRLLASTPDEYRHLIDLYDAASDRVDVVAPGVDLEVFRPG-D-MAQSRAR--VGVDPADDLLLFVGRIQPLKAPDL 259 Frankia
WP_010985435 207 VAAADRLIANTSEEADELVRHYEAERGKVAVVHPGVNLDRFRPA-DgRAAARAR--LGLPQDALIPLFAGRIQPLKAPDV 283 Streptomyces av...
3C4Q_A       241 LIKAVAALFDRDPD--R--NLRVIICGGPSGPN-ATPDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFN 315 Corynebacterium...
WP_011265551 243 LIKAVAALFDRDPD--R--NLRVIICGGPSGPN-ATPDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFN 317 Corynebacterium...
WP_006770340 241 LIHAVAELLERDPQ--R--NLRVLICGGPSGPS-ATPETYRNLAVELGVDKRIRFLDPRPPEELVAVYRAADIIAVPSYN 315 Corynebacterium...
WP_005251940 249 LLRAAAELIARDPE--S--TLRVLVVGGPSGSGlARPDALIELASSLGIAARVTFLPPQAPDRLVDVYRASDLVAVPSYS 324 Rhodococcus opacus
WP_005292156 241 LLRAVAELLDRHPQ--Q--QLAVVICGGSSGAGgNELERLQLLAEELGISRCVRFLAPRPPEELVGVYRAADIVAVPSYN 316 Corynebacterium...
WP_011211726 251 LVRAAAELLRRDPG--R--ALRVLIVGGPSGSGlQRPDALIELAAELGISERVTFLPPQPPERLVQVYRAADLVAVPSYS 326 Nocardia farcinica
WP_010934263 244 LLRAVAEMLERDPD--R--DMRVIMCGGPSGAA-ATVEHYIELTRSLGIAHRVRFLDPRPPEELVSVYQAADVVAVPSYN 318 Corynebacterium...
WP_016189367 242 LLRAAARLLELNPSlrD--RLVVAVVGGQSGTGyREPWLLSDLADSLGIADLVRLEPPCPRAELVHYYRAATVTVVPSHS 319 Thermobifida fusca
WP_003917307 280 VLRAAAKL----PG------VRIIVAGGPSGSGlASPDGLVRLADELGISARVTFLPPQSHTDLATLFRAADLVAVPSYS 349 Mycobacterium t...
WP_011434919 260 LLRAAAELLRRDPA--RrsRLTVAVVGGPSGSGlEQPDALVKLAAYLGISDRVRFQPPAPQQELVHWYRAATAVVVPSHS 337 Frankia
WP_010985435 284 LLRAVAVLLDERPElrS--NLVVPVVGGPSGSGlAKPEGLQKLAARLGIADVVRFRPPVGQEQLADWFRAASVLVMPSYN 361 Streptomyces av...
3C4Q_A       316 ESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLD--DDETRIRMGEDAVEHARTFSWAA 393 Corynebacterium...
WP_011265551 318 ESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLD--DDETRIRMGEDAVEHARTFSWAA 395 Corynebacterium...
WP_006770340 316 ESFGLVAMEAQATGTPVVAARVGGLPVAVAEGETGLLVDGHDPALWADTLATLLD--DDETRIRMGQDAVEHARNFSWAA 393 Corynebacterium...
WP_005251940 325 ESFGLVAIEAQACGTPVIAANVGGLGVAVRNGETGLLVDGHRTEDWATALQSLVS--EPGRLAALAAEAPRHAENFSWEH 402 Rhodococcus opacus
WP_005292156 317 ESFGLVALEAQACGTPVVATRTGGLPIAVDGGKSGLLVDGHDPSDWADALGKLVL--DDDLRIAMGEYAPSHAAKFSWQA 394 Corynebacterium...
WP_011211726 327 ESFGLVAIEAQASGTPVLAADVGGLSTAVRDGATGLLVRGHETADWADALGALLG--DRDRLRRMGLRAVAHAAGFSWAH 404 Nocardia farcinica
WP_010934263 319 ESFGLVAMEAQASGTPVVAARVGGLPIAVVDGETGVLVDGHDPIMWADALEQLLD--DDPTRQQMGVAAVEHAANFTWAA 396 Corynebacterium...
WP_016189367 320 ESFGLVAVESQACGTPVVAARVGGLPTAVRDGVSGVLIDGHDPHDYANVLHRMIT--EPRWRERMGAAGIHHASGLSWES 397 Thermobifida fusca
WP_003917307 350 ESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWADAIDHLLRlcAGPRGRVMSRAAARHAATFSWEN 429 Mycobacterium t...
WP_011434919 338 ESFGLVALEAQACGTPVVAAAVGGLRTAVADGVSGLLVSGRTPAVYADALDRLLR--QPRWRARLSAGAVAWAGGFGWSA 415 Frankia
WP_010985435 362 ESFGLVAIEAQAAGTPVLAASVGGLPVAVADGRTGFLVQGHDPAAYARVLRDFAD--DPALSARMGRAAARHAECFGWDT 439 Streptomyces av...
3C4Q_A       394 TAAQLSSLYNDAIAN 408 Corynebacterium glutamicum
WP_011265551 396 TAAQLSSLYNDAIAN 410 Corynebacterium glutamicum
WP_006770340 394 TATQLSSLYSEATTA 408 Corynebacterium efficiens
WP_005251940 403 TADGLLESYRMATVN 417 Rhodococcus opacus
WP_005292156 395 SAEALHKLYEELPPA 409 Corynebacterium jeikeium
WP_011211726 405 TAEGLLESYSAALWE 419 Nocardia farcinica
WP_010934263 397 AAEKLESVYGDAAMl 411 Corynebacterium diphtheriae
WP_016189367 398 TVDGLLAAYRDALHQ 412 Thermobifida fusca
WP_003917307 430 TTDALLASYRRAIGE 444 Mycobacterium tuberculosis
WP_011434919 416 TAHGVLRSYRHALSP 430 Frankia
WP_010985435 440 AASATADVYTAAMQA 454 Streptomyces avermitilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap