2C27


Conserved Protein Domain Family
mycothiol_MshD

?
TIGR03448: mycothiol_MshD 
Click on image for an interactive view with Cn3D
mycothiol synthase
Members of this family are MshD, the acetyltransferase that catalyzes the final step of mycothiol biosynthesis in various members of the Actinomyctes, Mycothiol replaces glutathione in these species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 132489
View PSSM: TIGR03448
Aligned: 12 rows
Threshold Bit Score: 328.977
Threshold Setting Gi: 499921431
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2C27_A         5 DWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLREL---GQ-QRTEHLLVA--------GS---------RPgg--pI 61  Mycobacterium t...
AAA62968       5 NWRFALSADEQRLVREIISAATEFDEVSPVGEQVLREL---GY-DRTEHLLVT--------DS---------RPya--pI 61  Mycobacterium l...
WP_011723739   5 DWRRTLNPQEQREVRELVGAATEFDAVAPVGEQVLREL---GH-DRTEHLLIR--------GSvsg---gaaDA-----V 64  Mycobacterium a...
WP_011597161   7 SWTDRLDGKQAADVSALLERATAADGTAPVSEQGVHAVsgaGS-DGVRHLVET--------DA---------DR-----I 63  Rhodococcus
WP_011561901   5 DWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQVLREL---PA-DRTRHLVAV--------DP---------DAg---aV 60  Mycobacterium
WP_011207131   7 RWTQRLDGETADAVRELLAAASAADGVAPVSEQAVLSLgepGA---ARHLLAE--------HD---------GE-----L 61  Nocardia farcinica
WP_011015225   9 STQIALDRDLREQALLLLKEVRAVDGVDALSEQFVRGLaepGL-GHS-HLIVT--------LN---------DK-----L 64  Corynebacterium...
WP_010985487  16 ETLAALSPGQAEAVLALLDEAARVDGQPAVSEQGRLQLrggER-EGVRHLLLS--------AG---------DT-----L 72  Streptomyces av...
WP_006769174  13 TTHLYNHRDLREQAMIMLKEVRAIDGVEALSEQFVRGLaepGL-GHTHYTVSV--------DG---------R------I 68  Corynebacterium...
WP_011775629  13 IIAGALDTELLRDVKTLAAAAGESDGNPPFSEQTLVTLr--GA-DAGDHSVLSfvlyapdeDS---------DPataedL 80  Arthrobacter au...
WP_010935426   6 TSLASASAALRDRVDEILAAATREDGCAPLSESFLNGLrraDD-GHVHSCVMD--------SH---------DQ-----V 62  Corynebacterium...
WP_011602165  15 TWQPTLSAADVDDIVSLLATAERADGTGPVSEDVRLTLrpdQRvGAARHLLAV--------SAtgveasgprRP-----I 81  Frankia alni
2C27_A        62 IGYLNLSPPRGAGGAMAELVVHPQSRRRGIGTAMARAALAKTA---GRNQFWAHGTLDPARATASALGLVGVRELIQMRR 138 Mycobacterium t...
AAA62968      62 IGYLNLSSPRDAGVAMAELVVHPRERRRGVGAAMVRAALAKTG---GRNRFWAHGTLASARATASVLGLVPVRELVQMQR 138 Mycobacterium l...
WP_011723739  65 VGYLNLTPPRDAQPQMAELVVHPRARRRGIGSALARAALAKTG---AANRFWAHGTLEPARATAAALGLSPVRELMQMRR 141 Mycobacterium a...
WP_011597161  64 VGYAQLQPGRGDHPAMAELAVDPAARGRGIGGRLVAEVLSEGG---PDARVWAHGNLPAAQAVAQRLGLIGARELLQLRR 140 Rhodococcus
WP_011561901  61 VGYLNLAPASDTAPPMAELVVHPDFRRRGTGAAMARAGLAEGG---THARIWAHGNLEAARATARTLGLQVVRELLQMRR 137 Mycobacterium
WP_011207131  62 AGYANLVPAHGDHPAMAEAAVAPARRGRGIGTALVREALAAGG---ADARVWAHGDRPAAKAVAARLGLRTARELWQMRR 138 Nocardia farcinica
WP_011015225  65 VGLAA------TDEETTELAVHPAHRRQGIGKALIDATPTS--------SIWAHGNTAGAQALASTLRMKKTRELLVMEI 130 Corynebacterium...
WP_010985487  73 VGYAQLEDTDPVEAPAAELVVHPAHRGRGHGRALGTALLAATG---KRLRAWAHGGHSAARHLAQVLGLTLFRELRQMRR 149 Streptomyces av...
WP_006769174  69 IGLGA------TDGETSELAVHPAHRRQGIGRELIDALPTDG--------VWAHGDLPPAQALASSLGLNKTRELLVMAV 134 Corynebacterium...
WP_011775629  81 AGVAVVVE-NGDESGVLELAVHPSYRNQGVAGRLLDALQGKRGl--GGLSAWSHGNHEAAAELATRFGYGPVRELWKMRL 157 Arthrobacter au...
WP_010935426  63 VGVAA------RDGDSAEVVVDPAFRRQGYGSFLIRHVVSQGV---K--NVWAHGDGAGAKAVAKALQLEQTRQLLVMAV 131 Corynebacterium...
WP_011602165  82 VGYAHLGGA--LDSRQAEIVVDPGHRGLGIGRALATALTEALGdppARLDVWAHGDLPPAAALAARLGFARTRVLFQLRR 159 Frankia alni
2C27_A       139 PLRD---IPEpTIPd--GVVIRTYAGTSD-----D-----AELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLI 203 Mycobacterium t...
AAA62968     139 SLRT---IPDpMVPdqlGVWVRTYVGTVD-----D-----AELLRVNNAAFAGHPEQGGWTATQLAERRSEPWFDPAGLF 205 Mycobacterium l...
WP_011723739 142 SLRDl-pDSVpAVP---GVRIRTYAGLAD-----D-----AELLRVNNAAFAYHPEQGGWTDVELAERRAEPWFDPAGLF 207 Mycobacterium a...
WP_011597161 141 PLADa-eLPElVVPe--DISLRVYRGVED-----D-----PEVLRVNAAAFAWHPEQGSWTERELAERRAEAWFDPSGLF 207 Rhodococcus
WP_011561901 138 PLTD---LPPvTVAd--GVRLATYSGPGD-----D-----PELLRINNSAFAWHPEQGGWTDADIAERRAEAWFDPAGLF 202 Mycobacterium
WP_011207131 139 SLATp-qLPElVVPd--GIVLRTYAGPAD-----D-----AELLRVNNAAFDWHPEQGGWTQRDIAVRRAESWFDPAGLF 205 Nocardia farcinica
WP_011015225 131 SDRAlddSAAyKDPd--GITHSSLANAPV-----EksvaeAKWLQSNNEAFDWHPEQGGWTTHRLAQAQKADWYKDSDVL 203 Corynebacterium...
WP_010985487 150 PLAGl-dLAEpKLPd--GVTVRAFVPGQD-----D-----AAWLAVNAAAFAHHPEQGSLTQRDLDDRKAEPWFDPAGFF 216 Streptomyces av...
WP_006769174 135 EGDAlreAAVyDNPa--GITNSSLKTAPGtrdevE-----GKWLKANNEAFHWHPEQGGWDRNRLTRAQSATWFRETDVL 207 Corynebacterium...
WP_011775629 158 MSSTs-aLPDaGLPd--GVSLRAFVPGQD-----E-----QAWLTANSAAFSHHPEQGSMTRADLEARKAEDWFDPEGFL 224 Arthrobacter au...
WP_010935426 132 EGDRlveSAQlQVPs--GFRVLALNEAYEsipdiE-----QQWLRVNNEAFEWHPEQGGWDSARLAQARDTQWFRESDVL 204 Corynebacterium...
WP_011602165 160 PLGAvapLPEpQLPa--GVTVRAFVPGRD-----D-----EAWLAVNAAAFADHPEQGRWTLDDLALRRAEPWFDPRGFF 227 Frankia alni
2C27_A       204 LAFGD-SprerPG-RLLGFHWTKVHP---D---H---------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRlg 266 Mycobacterium t...
AAA62968     206 LAFGD-SssnqPG-KLLGFHWTKVHA---A---H---------PGLGEVYVLGVDPSAQGRGLGQMLTSIGIASLAQRlv 268 Mycobacterium l...
WP_011723739 208 LAFGD-DdsdrPG-RLLGFHWTKVHL---D---Q---------PGLGEVYVVGVDPCAQGRGLGQALTAVGIEWLARRlg 270 Mycobacterium a...
WP_011597161 208 MAFAA-S----DDqRLLGFHWTKVHPkqgD---E---------PAIGEVYVVAIGPDAQGRGLGRLLTLAGLHYLRDR-- 268 Rhodococcus
WP_011561901 203 MAFDD-A----SG-KLLGFHWTKVHG-----------------PDLGEVYVVGVDPAAQGRGLGATLTLTGLHHLAERls 259 Mycobacterium
WP_011207131 206 LATDTaA----PD-RVLGFHWTKVHA---De--Q---------PPVGEVYVVGIDPAAQGRGLGRLLTLAGLHHLRER-- 264 Nocardia farcinica
WP_011015225 204 FLWD-------GE-EIVGFHWVKQHS-----------------PELQEIYVVGLSSAYRGRGLGDPLVRLGLHHMRAH-- 256 Corynebacterium...
WP_010985487 217 LAERD-------G-ELIGFHWTKVHA---Q---E----------GIGEVYVLGVRPGAQGGGLGKALTTIGLRHLEAQ-- 270 Streptomyces av...
WP_006769174 208 FLWD-------GD-ELVGFHWVKKHS---D---E-----------LQEIYVVGLAEAYRGKGLGDPLVRLGLRHMVNG-- 260 Corynebacterium...
WP_011775629 225 LAVN--A----EG-ELLGFHWTKVHP---RqgpH---------PAIGEVYVVGVTPEAQGLGLGKALTVAGIKHLQDQ-- 283 Arthrobacter au...
WP_010935426 205 FLIDT-A----KR-TVAGFHWTKRHG---Dl-aE---------GADGEVYVVGLGSAYRRRGLGDLLIRMGLHHLEYE-- 263 Corynebacterium...
WP_011602165 228 VAERD-------G-QLVGFHWTKIHE---V---DetpppgtrpGPIGEVYVVGVLPGAGGAGLGRALTLIGLRHLQAE-- 291 Frankia alni
2C27_A       267 grktldpaVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAY 308 Mycobacterium tuberculosis
AAA62968     269 g-----psAEPTVMLYVESDNVAAARTYERLGFTTYSVDTAY 305 Mycobacterium leprae
WP_011723739 271 ag---dsaADPTVMLYVEADNVAAVRTYQRLGFTTYSVDTAY 309 Mycobacterium avium
WP_011597161 269 --------GLGAVLLYVEGDNESALHTYDRLGFERFHTDVAY 302 Rhodococcus
WP_011561901 260 ------nsPQPTVMLYVEADNGAAVKTYRRLGFDVSSvdaay 295 Mycobacterium
WP_011207131 265 --------GLGGVLLYTEADNTAAVNTYTKLGFAPAHVDVAY 298 Nocardia farcinica
WP_011015225 257 --------GARKVILYVEAGNTPAVAAYEKLGFTVAESHVVY 290 Corynebacterium glutamicum
WP_010985487 271 --------GLPTAMLYVDADNKAAVSVYERLGFATHETDLMY 304 Streptomyces avermitilis
WP_006769174 261 --------GARRVILYVEADNDSAVAAYEKLGFTVAERHVVY 294 Corynebacterium efficiens
WP_011775629 284 --------GLHAVMLYVDADNEAAVALYQKLGFVRWDTDVMY 317 Arthrobacter aurescens
WP_010935426 264 --------HARRVILYVEGDNESARRAYDALGFHVVESHVTY 297 Corynebacterium diphtheriae
WP_011602165 292 --------GLAAVLLYVDEDNERAVRMYTGLDFTVHTRDVSY 325 Frankia alni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap