3C8Z


Conserved Protein Domain Family
mycothiol_MshC

?
TIGR03447: mycothiol_MshC 
Click on image for an interactive view with Cn3D
cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase
Members of this protein family are MshC, l-cysteine:1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase, an enzyme that uses ATP to ligate a Cys residue to a mycothiol precursor molecule, in the second to last step in mycothiol biosynthesis. This enzyme shows considerable homology to Cys--tRNA ligases, and many instances are misannotated as such. Mycothiol is found in Mycobacterium tuberculosis, Corynebacterium glutamicum, Streptomyces coelicolor, and various other members of the Actinobacteria. Mycothiol is an analog to glutathione. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 132488
View PSSM: TIGR03447
Aligned: 13 rows
Threshold Bit Score: 703.022
Threshold Setting Gi: 500011296
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C8Z_A         4 QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTP-GP-----TATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHT 77  Mycobacterium s...
WP_011594098   2 QSWSETAVPSVPGQGPPLRLFDTADRQVRPVTP-GR-----TATMYVCGITPYDATHLGHAATYLTFDLVNRIWRDAGHD 75  Rhodococcus jostii
WP_011729628   2 QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTP-GP-----TATMYVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHT 75  Mycobacterium s...
WP_011014417   2 QSWPTPEVPALAGTPVPLELFDTADQEVRLVET-PPagsdtPVGMYVCGITPYDSTHLGHAATYLAFDLIYRILLDNDHD 80  Corynebacterium...
WP_010934934   2 QSWPMPTIPSVPGKPAVLSLFDTSDQLIKPVEVdTP-----EVGVYVCGITPYDSTHLGHAATYLTFDLINRQLIDAGHR 76  Corynebacterium...
WP_011273536   2 HSWPEPEVPQLPGEAPQLRLYDTADDVVKPVEI-PAg----EVGMYVCGITPYDSTHLGHAATYLTFDLIHRYLRAAGHG 76  Corynebacterium...
WP_011209466   2 QSWSDTALPTVPGAGPPLRLYDTADRQVRPVAP-GA-----TATMYVCGITPYDATHLGHAATYLTFDLVNRVLRDGGHD 75  Nocardia farcinica
WP_006767639   2 HSWPTPDIPALDGTPVPLALYDTADQQVKPVEV-PPsgsgtPVGMYVCGITPYDSTHLGHAATYLAFDLIYRVLLDNDHQ 80  Corynebacterium...
WP_005296309   2 HAWPDPSVPVVAGTPVPLKLFDTADQRVKEVDT-TPda-ngEVGMYVCGITPYDSTHLGHAATYLTFDLAQRQLLANGHK 79  Corynebacterium
WP_003977162   2 HAWPASEVPALPGQGRDLRIHDTATGGPVTLDP-GP-----VARIYVCGITPYDATHMGHAATYNAFDLVQRVWLDTKRQ 75  Streptomyces
WP_011292256   4 RSWPAPTVVALPDHGGPLSVHDTVTGSRRTITP-GA-----TARMYVCGITPYDAAHLGHAFTYLTFDLVNRVWRDAGHT 77  Thermobifida fusca
WP_011774855   2 KSWTSRPVPELPGSMPQLRLYDTALGRVVDVER-QP-----EQSMYVCGITPYDATHMGHAASYVAFDLLNRAWRDAGVR 75  Arthrobacter au...
WP_011692014   2 KSWISRPVPQLPGRMPAVRIFDTAVGAYSTLDA-TG-----EQSLYVCGITPYDATHMGHAASYVAFDLLNRAWRDGGQR 75  Arthrobacter sp...
3C8Z_A        78 VQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAYIV--- 154 Mycobacterium s...
WP_011594098  76 VHYVQNVTDVDDPLFERANRDGEDWVVLGMRETALFREDMEALRVLPPRDYIGAVESIGEVIEMVEKFVASGAAYVV--- 152 Rhodococcus jostii
WP_011729628  76 VQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAYIV--- 152 Mycobacterium s...
WP_011014417  81 VHYVQNITDVDDPLFERAARDGVDWRDLGTSQINLFRSDMEALSIIPPKDYIGAIESIDEVIEMVKTLLDEGAAYIV--- 157 Corynebacterium...
WP_010934934  77 VHFVQNITDVDEPLFERALRDGVDWRELGSSQIDLFRSDMENLSVIPPRHYVGAMESIPEVIAMVETMLANGTAYIV--- 153 Corynebacterium...
WP_011273536  77 VHYVQNITDVDDPLFERAERDGVDWQDLGTSQIDLFRSDMEDLAVIPPRDYIGAMESIDEVIEMVAKLLEVGAAYQL--- 153 Corynebacterium...
WP_011209466  76 VHYVQNVTDVDDPLFERAARDGVDWRELGSREIELFRTDMAALRVLPPREYVGAVESVEEVVEFVQKLLANGAAYVV--- 152 Nocardia farcinica
WP_006767639  81 VHYVQNITDVDDPLFERAERDGVDWRELGTSQIDLFRKDMETLAVIPPKDYIGAIESIDEVIEMVSTLLEEGAAYVV--- 157 Corynebacterium...
WP_005296309  80 VHYAQNITDVDDPLFERAERDGVDWRELGTSQINLFRSDMEILSVIPPRDYIGAMESVDEVIAMVQQLLDAGAAYEL--- 156 Corynebacterium
WP_003977162  76 VHYVQNVTDVDDPLLERAVRDGVDWTALAEQETALFREDMTALRMLPPQHYIGAVEAIPGIVPLVERLRDAGAAYEL--- 152 Streptomyces
WP_011292256  78 VDYVQNITDIDDPLLERAAATGQDWQELAAREIQVFREDMAALRILPPRAFLGVVESMDLIADFVARLRAQGVTYEV--- 154 Thermobifida fusca
WP_011774855  76 VSYVQNVTDIDDPLLERATATGVDWRELAQSQIDLFQTDMDALNVLAPNHYIGAVEAIPDIVPAIEQLIADGVAYRVags 155 Arthrobacter au...
WP_011692014  76 VAYVQNVTDVDDPLLERATATGVDWRDLAASQIELFQTDMAALNVLAPDHYVGAVESIPEIVPAIERLLHLGLAYRVtgt 155 Arthrobacter sp...
3C8Z_A       155 EDAEYPDVYFRADATAQ----------FGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWP-S-PF 222 Mycobacterium s...
WP_011594098 153 DDPEFPDVYFRANATEQ----------FGYESGYDRETMDKFFAERGGDPDRPGKEDPLDALVWRAVRPGEPSWP-S-PF 220 Rhodococcus jostii
WP_011729628 153 EDAEYPDVYFRADATAQ----------FGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWP-S-PF 220 Mycobacterium s...
WP_011014417 158 EDAEYPDVYASINATDK----------FGYESNYDAATMAEFFAERGGDPERPGKKNPMDALLWRAAREGEPSWE-S-PF 225 Corynebacterium...
WP_010934934 154 ESDSYRDIYASITATTQ----------FGYESHYSRELMEQFFAERGGDPERVGKKDSLDALIWRAHRLGEPSWD-A-PF 221 Corynebacterium...
WP_011273536 154 EGDEYPDIYADYTFLPQ----------FGYESRYDEQQMAEFFAERGGDPERPGKRHPMDALLWRAHREGEPKWD-S-PF 221 Corynebacterium...
WP_011209466 153 DDPDFPDIYFRTDATEQ----------FGYESGYDRATMERLFAERGGDPDRPGKRDPLDALLWRAARPGEPSWP-A-PF 220 Nocardia farcinica
WP_006767639 158 DDPEYPDVYASINATEN----------FGYESNYDAATMAELFAERGGDPDRPGKRNPMDALLWRAAREGEPSWE-S-PF 225 Corynebacterium...
WP_005296309 157 DQ---GDIYASIDATEQ----------FGYESNLDRATMEEYFAERGGDPDREGKRDPLDALIWRGHREGEPAWD-S-PF 221 Corynebacterium
WP_003977162 153 EG----DVYFSVEADPH----------FGGVSHLDAATMRLLSAERGGDPDRPGKKNPLDPMLWMAAREGEPSWD-GgTL 217 Streptomyces
WP_011292256 155 DG----DIYFSAADAPG----------FGSLSQLDRTAMLELFAERGGDPGRAGKKDPLDWLLWRAERPGEPAWD-T-PL 218 Thermobifida fusca
WP_011774855 156 EGEPDGDVYYDVETAGKrsdat-dawtLGDVSGLGEKEMLELFAERGGDPTRAGKRHALDPLLWRVARDGEPSWPgS-TL 233 Arthrobacter au...
WP_011692014 156 PGEPDGDVYYDVEAASKhsaeakdawtLGSVSGLSETEMLELFAERGGDPGRRGKRQALDPLLWRVARDGEPSWAgG-EL 234 Arthrobacter sp...
3C8Z_A       223 GRGRPGWHVECSAIALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGErRFARHYVHTGMIGWDGHKMSKSRGNLVLV 302 Mycobacterium s...
WP_011594098 221 GPGRPGWHIECSAIALNRIGSGFDVQGGGSDLIFPHHEYSAAHAESATGDrRFARHYVHTGMIGLDGEKMSKSRGNLVFV 300 Rhodococcus jostii
WP_011729628 221 GRGRPGWHVECSAIALTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVTGErRFARHYVHTGMIGWDGHKMSKSRGNLVLV 300 Mycobacterium s...
WP_011014417 226 GAGRPGWHIECSAIATNRLGHSFDIQGGGSDLIFPHHEFSAAHAEAAHGVeRMAKHYVHAGMISQDGVKMSKSLGNLEFV 305 Corynebacterium...
WP_010934934 222 GAGRPGWHVECSAIATHHLGSHFAIQGGGSDLIFPHHEFSAAHAEATFGEsRMAGHYVHTGMIGLDGTKMSKSLGNLVFV 301 Corynebacterium...
WP_011273536 222 GPGRPGWHIECSAIAVNRLGAPFAIQGGGSDLRFPHHEFSATHAEAAHGVdRMAHHYVHTGMIGLDGTKMSKSLGNLVFV 301 Corynebacterium...
WP_011209466 221 GAGRPGWHIECSAIALNRLGPEFDIQGGGSDLIYPHHEYSAAHAESVVAGrRFARHYVHAGLIGLDGEKMSKSRGNLVLV 300 Nocardia farcinica
WP_006767639 226 GPGRPGWHIECSAIATNRLGHSFDIQGGGSDLMFPHHEFSAAHAEAAHGVeRMAKHYVHAGMISQDGVKMSKSLGNLEFV 305 Corynebacterium...
WP_005296309 222 GPGRPGWHVECSAIATNRLGSHFAIQGGGSDLAFPHHEFSAAHAEAALKVeRMAGHYVHAGMIALDGVKMSKSLGNLVFV 301 Corynebacterium
WP_003977162 218 GRGRPGWHIECVAIALDHLGMGFDVQGGGSDLAFPHHEMGASHAQALTGEfPMAKAYVHAGMVGLDGEKMSKSKGNLVFV 297 Streptomyces
WP_011292256 219 GRGRPGWHVECSAISVHELGMGFDLNGGGDDLIFPHHEMGAAEACCATGSrPQARHYLHVAMVGLDGEKMSKSRGNLVFV 298 Thermobifida fusca
WP_011774855 234 GDGRPGWHIECTVIAQKYLPAPFTVQGGGSDLVFPHHEMGAGHAYSLSGV-PLARHYSHAGMVGLDGEKMSKSKGNLVLV 312 Arthrobacter au...
WP_011692014 235 GSGRPGWHIECTVIAQKYLPAPFTVQGGGSDLIFPHHEMGAGHAYSLTGV-PLARHFAHAGMVGLDGEKMSKSKGNLVLV 313 Arthrobacter sp...
3C8Z_A       303 SQLRAQGVDPSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSAT-A--LPEAPDATDVIARVRQYLADDLDTPKALA 379 Mycobacterium s...
WP_011594098 301 SKLRGEGVDPAAIRLGLLSGHYRQDRPWTEQLLADAHTRLQLWKDAA-A--LESAPSATDTIARLRQHLADDLDTPKALD 377 Rhodococcus jostii
WP_011729628 301 SQLRAQGVDPSAIRLGLFSGHYREDRFWSNEVLDEANARLARWRSAT-A--LPEAPDATDVIARVRQYLADDLDTPKALA 377 Mycobacterium s...
WP_011014417 306 SRLTAAGHEPGAIRLGVFANHYRGNRDWNAESLATAEQRLATWREAArA--ATNREDAIAVVEQLRAHLSADLDTPGALA 383 Corynebacterium...
WP_010934934 302 SRLTSEGYHPSDIRLGVFAGHYRDDRDWSTDLLTAAQERRQAWITAA-Dn-ARDVQQVQQTIQKIRHLLANDLNTPAVLA 379 Corynebacterium...
WP_011273536 302 SRLTAAGHEPAAIRLGVYAGHYRQDRDWTNDVLAHAEHRLASWRAAL-AtgSTTLDEARELVATVRGHLANDLDTAAALE 380 Corynebacterium...
WP_011209466 301 STLRKDGVDPAAIRLGLLDGHYRQDRMWTDAVLEAALARLARWRSAT-A--LSAGPAAHDTIARLRQHLADDLDSPKALA 377 Nocardia farcinica
WP_006767639 306 HRLTAAGHEPGAIRLGVYAHHYRGDRDWSDEILAAAEARLALWRSAI-Tv-ATDVQAAVDAVAQLRTHLSNDLDTPAALA 383 Corynebacterium...
WP_005296309 302 HKLSEAGHDPSAIRLAVFAGHYREDRDFSDAILAEAEERLTRWREQL-Ag-EVSEAEATEVVDKLRAILADDLNTPEALS 379 Corynebacterium
WP_003977162 298 SQLRREGVDPAAIRLTLLAHHYRSDWEWTDQVLQDALARLDRWRAAV-S--RPDGPPAEALVEEIREALANDLDSPAALA 374 Streptomyces
WP_011292256 299 SQLRKAGTDPMAIRLALLAHHYRTAWEWTDADLRTAEQRLERWRAAA-A--VENAPDARPLLARVRSALADDLDTATALA 375 Thermobifida fusca
WP_011774855 313 SKLRAAGEEPAAIRLAILAHHYRSDWSWTDAEFAEAKDRLKQWRAAL-D--HAPAGSAAALISAMRDELANDLNAPGAIA 389 Arthrobacter au...
WP_011692014 314 SKLRAAGEEPAAIRLAILAHHYRTDWSWTEAGFAQAKTRLAEWRDAL-T--MAPGESAATLIAEMRSELANDLNAPGALA 390 Arthrobacter sp...
3C8Z_A       380 ALDGWCTDALSYGGHD--TE------------SPRLVATTVDALLGVDL 414 Mycobacterium smegmatis
WP_011594098 378 ALDGWARRALDHGGSD--TN------------APSEFAAAVDALLGVRL 412 Rhodococcus jostii
WP_011729628 378 ALDGWCTDALSYGGHD--TE------------SPRLVATTVDALLGVDL 412 Mycobacterium smegmatis
WP_011014417 384 AVDNWAAGIDTTTDSKefTE------------VGNIVVAAIDALLGVQL 420 Corynebacterium glutamicum
WP_010934934 380 EVDNWANLIPLNDSAR--TE------------AGRLMASGLDALLGVKI 414 Corynebacterium diphtheriae
WP_011273536 381 ALDDWAADTKTGAAGD--EA------------AASEIKTAIDALLGVRL 415 Corynebacterium jeikeium
WP_011209466 378 AVDNWVTEALDYGGSD--SG------------APAAIAEAVDALLGVRL 412 Nocardia farcinica
WP_006767639 384 AVDAWAEAALKDTGNV--SDtadqfdtpeftpAGRILAAAVDALLGVRL 430 Corynebacterium efficiens
WP_005296309 380 LLDGAAGD------------------------CNQIIATALDGLLGVRI 404 Corynebacterium
WP_003977162 375 AVDRWAALQQESGGTD--IG------------APGVVSRAVDALLGVAL 409 Streptomyces
WP_011292256 376 AVDEWADAALSGSGDD--PD------------APALMRTTVDTLLGVAL 410 Thermobifida fusca
WP_011774855 390 AVDHWAAEAIRSGSDK--SEq-----------DTALVTDAIDALLGVEL 425 Arthrobacter aurescens
WP_011692014 391 AVDRWAVAAKQQAGAG--SPm-----------DQALVSDAVNALLGVEL 426 Arthrobacter sp. FB24
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap