Conserved Protein Domain Family
mycothiol_Mca

?
TIGR03446: mycothiol_Mca 
mycothiol conjugate amidase Mca
Mycobacterium tuberculosis, Corynebacterium glutamicum, and related species use the thiol mycothiol in place of glutathione. This enzyme, homologous to the (dispensible) MshB enzyme of mycothiol biosynthesis, is described as an amidase that acts on conjugates to mycothiol. It is a detoxification enzyme. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 132487
View PSSM: TIGR03446
Aligned: 10 rows
Threshold Bit Score: 463.823
Threshold Setting Gi: 500010312
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011691030  11 LRLLAVHAHPDDESSKGAATMAMYAAAGVDVMVATCTDGSRGDIQNPAMEHePH-PKR--DMAGARRLEMDNAAKVLGIR 87  Arthrobacter sp...
AHK29702       8 FRLMAVHAHPDDESSKGAATTARYAAEGNEVKVVTLTGGERGDILNPAMDV-PG-VRD--RIHEVRIEEMAEAARILGVQ 83  Rhodococcus opa...
WP_011265664   7 LRLMAIHAHPDDESSKGAATMARYAAEGNQVMVVTCTGGERGDILNPAMDK-PG-ILD--NIFAVRQEEMAKAMEILGTE 82  Corynebacterium...
WP_003896662   4 LRLMAVHAHPDDESSKGAATTARYAAEGARVMVVTLTGGERGDILNPAMDL-PE-VHG--RIAEVRRDEMAKAAEILGVE 79  Mycobacterium s...
WP_030026097   4 LRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDL-PD-VHG--RIAEIRRDEMTKAAEILGVE 79  Mycobacterium t...
WP_003850849   8 ARLLAIHAHPDDESSKGAATMAKYVAEGHEVMVVTCTGGELGDVLNPSLDK-TA-VEG--RIAEVRREEMAQAVKELGVQ 83  Corynebacterium...
WP_003974009   5 LRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQG-DAyIEE--NIHEVRRKEMDEAREILGVG 81  Streptomyces
WP_011273902  13 YRLLAIHAHPDDESSKGAATMARYVDEGHRVKVLTCTGGERGDILNPEMQE-LA-EQGigEMIEVRREEMAQAASILGVE 90  Corynebacterium...
WP_011290896   5 LRLMAVHAHPDDESSKGAATMARYVNEGAEVLVVTLTGGERGSILNPAMDR-PE-IRE--NIAEVRRKEMEEARRILGVR 80  Thermobifida fusca
WP_011438277  13 LRLMAIHAHPDDESSKGAATMARYASEGADVLVVTCTGGEEGSILNPAMDQ-PG-VAA--RMAEIRRQEMEAARLILGVR 88  Frankia
WP_011691030  88 QRWLGFVDSGLPEGDPLPPLPPGSFALQPLEVAAAPLVRLVRDFKPHVIVSYDENGGYPHPDHIMAHRVAVEAFEAAGDP 167 Arthrobacter sp...
AHK29702      84 HQWLGFVDSGLPEGDPKPPLPEGCFALVPLEESTEALVRVIREFRPHVMTTYDENGGYPHPDHIRCHEVSMAAYEAAADP 163 Rhodococcus opa...
WP_011265664  83 HRWLGYEDSGLPQGDPLPPLPEGCFALEDSDKVTQDLVKILREFRPHVIITYDENGGYPHPDHLKVHEVSMLAWEKSGDA 162 Corynebacterium...
WP_003896662  80 HHWLGFVDSGLPEGDPLPPLPDGCFALVPLEEPVKRLVRVIREFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAADH 159 Mycobacterium s...
WP_030026097  80 HTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVVREFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDF 159 Mycobacterium t...
WP_003850849  84 HRWLGYHDSGFPEGEPHPPVPPGSFALEDSDEVAAKIVEIIREFRPHVIVTYDENGGYPHPDHLKVHEVSMLAWDLAGDP 163 Corynebacterium...
WP_003974009  82 QEWLGFVDSGLPEGDPLPPLPEGCFALEDVDKAAGELVRKIRSFRPQVITTYDENGGYPHPDHIMTHKITMVAFEGAADT 161 Streptomyces
WP_011273902  91 HEWLGYVDSGLPEGDPKPPLPEGCFALEDTDEVTQNVVRVVREFRPHVIITYDEYGGYPHPDHIKVHAVSVRAWEAAGDP 170 Corynebacterium...
WP_011290896  81 QVFVGFIDSGLPEGDPPPPLPEGCFALQPLEVAAEPVVRLVREFRPHVMITYDEQGGYPHPDHIMCHKVSVEAFEAAADP 160 Thermobifida fusca
WP_011438277  89 QEWLGFVDSGLPEGDPPPPVPDGRFATIALGEAARPLVRLIRQFRPQVITTYDESGGYPHPDHIMTHRVSVEAFEAAGDP 168 Frankia
WP_011691030 168 ERYQGA--G-----EPWAPGKLYYDRAFSPDRFRALHFALEEAGLQSPYA--ERLAAWLEADAEghtpppPTHPTTTQIE 238 Arthrobacter sp...
AHK29702     164 ERFPDA--G-----EPWKVQKVYYSHGFIRKRLLQFQEEYDRRGEEFPMA--EWLKKWKTEQGD------LMARVTTQIT 228 Rhodococcus opa...
WP_011265664 163 AYAPEL--G-----APWEPLKLYYTHGFIRQRMEMFHDLLIEQGKPSPYT--PMLERWKANEAD------VMARVTTQVP 227 Corynebacterium...
WP_003896662 160 LLYPDA--G-----EPWAVQKLYYNHGFLRQRMQLLQEEFAKNGQEGPFA--KWLEHWDPDNDV------FANRVTTRVH 224 Mycobacterium s...
WP_030026097 160 CRFPDA--G-----EPWTVSKLYYVHGFLRERMQMLQDEFARHGQRGPFE--QWLAYWDPDHDF------LTSRVTTRVE 224 Mycobacterium t...
WP_003850849 164 DYRLDL--G-----QPWAPLKLYYTHGFIRQRMEMFHNLLVEQGKPSPYE--GILDRWLEHRAD------IMARVTTQVY 228 Corynebacterium...
WP_003974009 162 EKYPESeyG-----TAYQPLKVYYNQGFNRPRTEALHHALLDRGLESPYE--DWLKRWSE-FER------KERTLTTHVP 227 Streptomyces
WP_011273902 171 NYHPEL--G-----EPWEVKKLYYTHGFIRERFENLATAMYERGAQLPEQvlQHLEMWR-QLPD------IFSRVTTRVN 236 Corynebacterium...
WP_011290896 161 ERYPGT--G-----EPWQTSKLYYHVSFPLERFEAIAKVLSDRGMENPYA--DWMKRL-EKRDT------RRWEITTRVE 224 Thermobifida fusca
WP_011438277 169 DRYPEV--GvdaglEPWQPLKLYYHLTFHKERVLALHEEMMARGLESPYA--ERLAEW-VDRAE------DTGRLTTQVE 237 Frankia
WP_011691030 239 CGDYFEARDDALRAHRTQVDPLGFFFAVSPDMQRRAWPWEDYSLIQSRVPVE-LPEKDLFAGL 300 Arthrobacter sp. FB24
AHK29702     229 CGDYFPQRDDALRAHATQIDPNGSFFAVPLEIQQKIWPTEEFELAKTRVTTS-IPENDLFAGI 290 Rhodococcus opacus PD630
WP_011265664 228 CERFFDQRDDALRAHATQIDPAGAFFGTPVEVQRRLWPTEEFELAKTRVKTS-IPEDDLFAGI 289 Corynebacterium glutamicum
WP_003896662 225 CAEYFHQRDDALRAHATQIDPKGDFFHAPIEWQQRLWPTEEFELARARVPVT-LPEDDLFKGV 286 Mycobacterium smegmatis
WP_030026097 225 CSKYFSQRDDALRAHATQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPAR-PPETELFAGI 286 Mycobacterium tuberculosis
WP_003850849 229 AADYFDRRDAALKAHATQIDPAGTFFATPIETQQQLWPTEEFELARTRVSTS-LPEDDLFEGI 290 Corynebacterium diphtheriae
WP_003974009 228 CADFFEIRDKALIAHATQIDPEGGWFRVPMEIQKEVWPTEEYELAKSLVETS-LPEDDLFAGI 289 Streptomyces
WP_011273902 237 VADWFERRDDALRAHRTQIDPKGAFFLADMDLQKQVWPTEEFELAQSRVSSE-LPETELFAGL 298 Corynebacterium jeikeium
WP_011290896 225 CGEYFEVRDRALLAHATQIDPNSFWFAVPNDIQREAWPTEDYHLARSFVDTE-LPEDDLFAGI 286 Thermobifida fusca
WP_011438277 238 CADWFETRDRALIAHATQVDPTGWWFRIPLEVQRDAWPTEDYQLARSLIEVGmLPEDDLFNGV 300 Frankia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap