Conserved Protein Domain Family
TIGR03442

?
TIGR03442: TIGR03442 
ergothioneine biosynthesis protein EgtC
Members of this strictly bacterial protein family show similarity to class II glutamine amidotransferases (see pfam00310). They are distinguished by appearing in a genome context with, and usually adjacent to or between, members of families TIGR03438 (an uncharacterized methyltransferase) and TIGR03440 (an uncharacterized protein). [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 132483
View PSSM: TIGR03442
Aligned: 9 rows
Threshold Bit Score: 317.052
Threshold Setting Gi: 499917094
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011144315   1 MCRLLAYQGAPVALADLIEKPEHSLCVQSYQPKEMTSG-LLNADGFGFGWYDPARDSRPFRFRSTQPIWADANLGS-LGR 78  Gloeobacter vio...
WP_011320958   1 MCRLLAYLGSPVSLEYLLYKPEHSLIVQSYQPREMTSG-VVNADGFGVGWYHSQKDTEPFTYKNTLPIWNDINLPS-LSR 78  Anabaena variab...
WP_011611851   1 MCRLLGYLGEPILLESILTQPKHSLIVQSYQPQEMQES-LLNADGFGLGWYDTQKQTSPFTYKNTQPIWNDINLKS-LGG 78  Trichodesmium e...
WP_011057241   1 MCRLYAYMGRKTSLAHALVDAPHSLLVQSYQPREMTAG-LLNADGFGVGWYAARQDVLPFLYRQTIPMWQDINFTEhLSR 79  Thermosynechoco...
WP_011438867   1 MCRHLAWIGTPRTLAGLTLERPYSLLRQSWSPRRMRHG-TVNADGFGVGWYAPALRAAPARFRRAVPMWTDASYAS-IAG 78  Frankia
WP_011723534   1 MCRHLGWLGADATVSSLMLEPPFGLRVQSYAPRRQKHG-LLNADGWGAGFFDGE---VPRRWRSPAPLWGDVSFES-VAP 75  Mycobacterium a...
WP_011731157   1 MCRHVAWLGAPRSLADLVLDPPQGLLVQSYAPRRQKHG-LMNADGWGAGFFDDE--GVARRWRSDKPLWGDASFAS-VAP 76  Mycobacterium s...
WP_016325532   1 MCRHLAYAGPAEPLGDLIMAPPHGLYRQSWAPRHQRYG-TVNADGFGVGWYADG-DPVPARYRRAGPIWADQSFAD-LAR 77  Streptomyces li...
WP_011597828   1 MCRHLGYLGPEQSVGDLLSRGENSLLRQSYAPRDMRGGgTVNADGFGVGWWGSG---GFSRYRSAQPLWSDPVVRE-TLP 76  Rhodococcus jostii
WP_011144315  79 YVHSSCVLANVRSATPGLAVDLSNCQPFAFERILGLHNGFIQNFRQTLYRPIRDSLDDPFYKAIDGSTDSEHVFAFVLNT 158 Gloeobacter vio...
WP_011320958  79 YVESKCILAYVRSATAGQALDFANCQPFHYKQSLFIHNGYIENFRKTLHRKLRSTLTPDFYEHINGSTDSEHIFALLLSQ 158 Anabaena variab...
WP_011611851  79 YIESGCILGYVRSATLGQGIDISNCQPFNYKNILFIHNGYIDQFRSTLYKPIRDSLQDIPYLLINGNTDSEHIFALLINE 158 Trichodesmium e...
WP_011057241  80 YIESACFLANVRSATPGQAVQMTNTQPFRWGRWLGMHNGFIDNFRQTLYRPMRDRLSDICYNIVEGSTDSEHLFALFCNE 159 Thermosynechoco...
WP_011438867  79 AVASGCVLAAVRSATVGMPIEESATAPFTDGHRLLSHNGRVD--PVAVRRMLRDRPDAP---VPDSTCDSALLAALVWEH 153 Frankia
WP_011723534  76 ALHSHCVVAAVRSATAGMPIEISATAPFTDGRWLLSHNGVVD--RSVL--PVTSR--------AESVCDSAILAAVIFER 143 Mycobacterium a...
WP_011731157  77 ALRSRCVLAAVRSATIGMPIEPSASAPFSDGQWLLSHNGLVD--RGVL--PLTG--------AAESTVDSAIVAALIFSR 144 Mycobacterium s...
WP_016325532  78 VVRTGALLAAVRDATLAGADAEAAAAPFAAGAWLFSHNGAVAGWPGSL-APVAATLPPGELLSLEARNDSALVWALVLAR 156 Streptomyces li...
WP_011597828  77 NIRSRAVVAAARSATVGMPVQHTACAPFSDETWAFSHNGVVRGWPESL-GALAAELPVNDLLQLEAPTDSAALWLLLRRA 155 Rhodococcus jostii
WP_011144315 159 WERQG---GTLEDALTESIRTLAVWAAKEsvSVS--LNLIFADGERLVASRYANrpeapTLYWLADdptfP-EATIIASE 232 Gloeobacter vio...
WP_011320958 159 IQSNKh--RSVESVLRNTLLMLWEMAKRH--QVNasANVVFSDGHRLIASRFASsssppSLYWLKDdltfP-NSVIIASE 233 Anabaena variab...
WP_011611851 159 VLEIIk--YNFQEALHNILMFLKKIAQEN--KVKflANTIITDGHQLVASRFAQeasspSLYWLKNsskfP-NSVIIASE 233 Trichodesmium e...
WP_011057241 160 LVLNPq--LSPVMVLRQTLQIVFSLAQAA--RTRvsVAMILTDGLYILATRCSRgtpppTLYWSQD----A-EKIQLTSE 230 Thermosynechoco...
WP_011438867 154 AGk-----RPLAEAVAEVVLSLDAAGSGE--RAR--LNLLVVDGTQIVATAWRD-----SLSYRRE----K-DGVLVASE 214 Frankia
WP_011723534 144 GL------DALGEVIAEI------GAADP--AAR--LNILAANGSRLLATAWGD-----TLSILRR----A-DGVVVASE 197 Mycobacterium a...
WP_011731157 145 GL------DALGATIAEV------GELDP--NAR--LNILAANGSRLLATTWGD-----TLSVLHR----P-DGVVLASE 198 Mycobacterium s...
WP_016325532 157 LRAGDdegRALTETVLEV------AAAAP--ASR--LNLLLTNGSTVTATTWGD-----TLWYLSR----PgGGTVVASE 217 Streptomyces li...
WP_011597828 156 LGEQDp-eKAMSALVQDVV------AAAP--NSR--LNLLLGNGSELWATTWHH-----SLSALVD----D-ERAIVMSE 214 Rhodococcus jostii
WP_011144315 233 PLFASrGWQCVPPGSVLTVDAEsKISVQPI 262 Gloeobacter violaceus
WP_011320958 234 PLFAG-NWTACPENSIISVGEDcDIKIESI 262 Anabaena variabilis
WP_011611851 234 PLFAD-DWQKFPEQSITKVSENlDIQIYQI 262 Trichodesmium erythraeum
WP_011057241 231 PIDSEtEWYPLPENKLLLMSLQsEPEIYAF 260 Thermosynechococcus elongatus
WP_011438867 215 PDDDEpGWVDVPDHHLLVADTH-QVTLRNM 243 Frankia
WP_011723534 198 PYDDDsDWEDVPDRHLVDVTAD-GVTLTPL 226 Mycobacterium avium
WP_011731157 199 PYDDDpGWSDIPDRHLVDVRDA-HVVVTPL 227 Mycobacterium smegmatis
WP_016325532 218 PYDDDpHWREVPDRTLLTASRT-DVRLTPL 246 Streptomyces lividans
WP_011597828 215 PYDDNpAWQSIPDRHFVSARPG-HLIVTPL 243 Rhodococcus jostii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap