Conserved Protein Domain Family
urea_trans_yut

?
TIGR03441: urea_trans_yut 
urea transporter, Yersinia type
Members of this protein family are bacterial urea transporters, found not only is species that contain urease, but adjacent to the urease operon. It was characterized in Yersinia pseudotuberculosis. Members are homologous to eukaryotic members of solute carrier family 14, a family that includes urea transporters, and to bacterial proteins in species with no detectable urea degradation system. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 163267
View PSSM: TIGR03441
Aligned: 8 rows
Threshold Bit Score: 325.042
Threshold Setting Gi: 487750550
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004690961  18 IRFIDINLRGAGQVIFQNNPLTGLFFLAAIVW-----GaitvgQIAIAIGSVIALFVATSIAMLLGgDRLSLRQGMFGFN 92  Brucella
WP_011192841  21 IEFIDTALRGCAQVMFQNNPLTGLFFFIAIFI-----GaygegNPAVAYGCVLGTLVATLTGLSIR-DRKSWRSGLYGYN 94  Yersinia pseudo...
WP_031789969   1 MKIIDVLLKNISQVVLISNKWTGLFILIGLFV-----A-----DWTIGLAAIVGSIIAYTFARFINySEAEVNDGLAGFN 70  Staphylococcus ...
WP_011302252   1 MDAIRIVLKNISQVLLLNNAWTGLFILLGLFI-----G-----SWKVGVMALIASVIALLLAKRTNySEEEINTGLSGFN 70  Staphylococcus ...
WP_012752308   6 SNLLVQSLRGTSQVFFIENALTGVLFFAAMAYassvtG-----NWATTIGAAIGVLVATLTARLLEcDDPSVSSGLYGFN 80  Methylobacteriu...
WP_002811941   8 IKAVSVLLRGVGQVVFQNNPISGLVILTGLFF-----A-----SLAAGTAALVGVIVSTLTAVLLKvDKDLIGAGLLGFN 77  Nitrosococcus o...
WP_011380589  12 PQPLRVILRGVGQVFFCCNALTGLIFLIALFI-----G-----GVAAGAAATVGVLTSTVTAHLLAfSKKDIDAGLYGFN 81  Nitrosospira mu...
WP_001832405   1 MKLIKVILSSISQVVLINNPYTGLFILIGLFA-----V-----NWKVGISAMIASVMTWILAPYMNyTKEEIESGLAGFN 70  Staphylococcus
WP_004690961  93 GLLVGAAVPALL--------APRPAMWFILVIGAAVSTVVMLAVSKIMK-TWDAPALTFPFVLTTWFLV----------- 152 Brucella
WP_011192841  95 GCLVGAALPTFL--------IATPVLWACIVLGSIVSVIVTACIADILK-TWKLAALTAPFVLTTWVVL----------- 154 Yersinia pseudo...
WP_031789969  71 PVLTAIALTIFL--------DKSGLDIVITMIATLLTLPVAAAVREVLR-PYKVPMLTMPFVIVTWFTI----------- 130 Staphylococcus ...
WP_011302252  71 PVLTAIALTLFL--------VPKWYSLIIILVAIIITMPIGSAFREFFK-PFGVPMLTMPYVFVSWLIL----------- 130 Staphylococcus ...
WP_012752308  81 GVLVGAALPTFI--------AASPQLWASIVIGAAASTVFTAAFSATLTgKWGIPGSTGPFVLTGWLMV----------- 141 Methylobacteriu...
WP_002811941  78 GVLVGIAISLYSshnvtlgdLPVWKIWSLVVMGSAFSTVVMMALSRFLS-PWNMPALTMPFVLCAWIFVgsvehtvklet 156 Nitrosococcus o...
WP_011380589  82 GTLVGPCLFLFL--------EHSPQLWLYVILASILSSVVLAALMRILR-PYQVPASTSPFVLTSWMFL----------- 141 Nitrosospira mu...
WP_001832405  71 PVLTAIALTLFL--------DSNWSGILITFVATILTLPIGAAVREVLK-PHKIAFLTSPYVIMTWITL----------- 130 Staphylococcus
WP_004690961 153 ---LAAYAFGHLPI---DsmgPPALPHDASASA---QFSPSWFELLEAWLKGPAQVFLLNNAVSGVLVVvIGLLINSVWA 223 Brucella
WP_011192841 155 ---LASYAFAGLHSsglP---APVLPQQLVLEA---GNTFAGTNIFVSMFHGVSQVFLFSSLIAGILFV-IGLAIESLWA 224 Yersinia pseudo...
WP_031789969 131 ---LLSGQVKFVDT---S---LKLMPQNIETVN---FSNNDRIHFIQSLFEGFSQVFIEASVIGGVCIL-IGILIASRKA 197 Staphylococcus ...
WP_011302252 131 ---LMSFQFKFVNA---D---VNILPNAIQEIQ---FSGHH-IQFINAFLSGFSEIFLLKSVLAGTLIL-IGIFIASRKA 196 Staphylococcus ...
WP_012752308 142 ---AAAYSFGGLHVt-gD---APKLAGDVVPNL---TGIPAPMDLVAIFFRNIAQVYLLGSAVSGVIIL-AGILIASVPA 210 Methylobacteriu...
WP_002811941 157 pgaLESYAYQLFQ---------PEIGHRIEEYR-----QYTLETWYMGIGKGFSEIFLQDSAIAGYLIL-LGILINSRIS 221 Nitrosococcus o...
WP_011380589 142 ---VAVYGFESF-T---R---SPVLPAAGIPVAvpgAGGLAVENWPVALFKGVGEVMFADSVTVGILFL-AGIAIVSLRG 210 Nitrosospira mu...
WP_001832405 131 ---LIPNQLKTLHT---Q---IDIIPEHIEKVSl--NNDHTRVHFFQSVLDGFGQIFLMPSIIGGLLIL-IGIFIGSKKA 198 Staphylococcus
WP_004690961 224 GVFALFGSAIALSLSLALGASLADIEAGLFGFSPVLTAVGLGCVFFRPSLRVTLFAVLGTVFTVIVQGAMDVALTPLGIP 303 Brucella
WP_011192841 225 AVFALCGAILAILTATLLEADHHSINAGLYAFSAVLTAIALGSTFNKPSWRVLAYTVIGVIFTVFVQGALNTLLLPIGIP 304 Yersinia pseudo...
WP_031789969 198 ALLAVIASLLSFIIVALLGGNYDDINQGLFGYNFVLMAIALGYTF-KTAINPYISTFLGVLLTVVVQLGTTTLLEPFGLP 276 Staphylococcus ...
WP_011302252 197 GVYAIVANLIGFLAVIVLGANHDQINEGLFGYNVILTVLALGIAF-RTRIQRPISIVLGILLTVVIHAGMTTLLTPYGLP 275 Staphylococcus ...
WP_012752308 211 GIAAAAGSLISMIVAIAMGADPKAVSQGLYGFSPVLTAMAVGVVFLTPSPRVAVYAGLATVMTVFVQGALDVMVAPAGIP 290 Methylobacteriu...
WP_002811941 222 AIMGLLAALLSITAAMLFGVTEESIRLGLHSYNPILTALAV-VLFVRFTISSGFYALFGVVVTVWVSLAVGLALYHLEFP 300 Nitrosococcus o...
WP_011380589 211 ALMAVGGAFVGIVFPTLLNANLNAIEMGLYAFNPVLTMMAIGWVFLKPSGKSAALAVLAGLMTVVCQAGLASFLTPIGLP 290 Nitrosospira mu...
WP_001832405 199 GIVSIIANIIGFLIIILLGGDYSSINEGIFGYNVVLSAIALGVTF-ETAIHSYLAMILGIVLTAFIHLGLSTLLAPLGLP 277 Staphylococcus
WP_004690961 304 TFTAPFVFVTWLFLL 318 Brucella
WP_011192841 305 TLTMPFVLASWLFLV 319 Yersinia pseudotuberculosis
WP_031789969 277 ALTLPFIIVTWILLF 291 Staphylococcus aureus
WP_011302252 276 VFTLPFIIATWIMLF 290 Staphylococcus saprophyticus
WP_012752308 291 SFTAPYVLTMYLFIA 305 Methylobacterium extorquens
WP_002811941 301 VYTFPFVIVTWALLL 315 Nitrosococcus oceani
WP_011380589 291 TLTFPFVLVMWMFLF 305 Nitrosospira multiformis
WP_001832405 278 TLTWPFIFATWIMLF 292 Staphylococcus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap