Conserved Protein Domain Family
padR_acidobact

?
TIGR03433: padR_acidobact 
transcriptional regulator, Acidobacterial, PadR-family
Members of this protein family are putative transcriptional regulators of the PadR family, as found in species of the Acidobacteria. This family of proteins has expanded greatly in this lineage, and where it regularly is found in the vicinity of a putative transporter protein [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 163261
View PSSM: TIGR03433
Aligned: 44 rows
Threshold Bit Score: 133.45
Threshold Setting Gi: 499841354
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011687412   8 LQGTLALLILKTLAS-GKrMHGYAITAHVQRVSEQLLRVEEGSLYPALHRMEQEGWVRADWGK-TEKNRDARFYSLTACG 85  Candidatus Soli...
WP_015896654   8 LQGTLDLLVLKTLER-GP-MHGWGITVHIERVSDAMLRVEEGSLYPALHRMEKEGWIAASWGQ-SENNRRARFYRLTPRG 84  Acidobacterium ...
WP_011687522  11 LPGTLEMLILKTLSR-AS-NHGWGIAQHIQQTSEDALKIGEGSLYPALQRLLMNEFVEAEWGV-TENNRRARYYRITAAG 87  Candidatus Soli...
WP_011685645  11 LPGSLDMLILRTLSL-RD-LHGYGIVQFIQQCSDNELLVEEGSLYPALQRLELNGWIDGVWGV-TSNNRRARIYKITAAG 87  Candidatus Soli...
WP_011684248   7 aQTALDMLVLTILSRrGP-SHGYGLANAIQELSEEALRVEEGSLYPALHRMEEAGWIAAEWMV-TENKRRARIYRISRAG 84  Candidatus Soli...
WP_011688743   7 LQGSLDLLVLKILSR-RPrLHGYALMTAIQEISEDVLRVEEGSLYPALHRMEEAGWIRAEWVT-KETGRRARIYDLTPAG 84  Candidatus Soli...
WP_011685338   8 LQGTLDLLILHSLGR-GP-LHGYAIAQTIHLLSDEVLTVEEGSLYPALYRLELDGALSSSWGL-SENNRKAKYYEITRRG 84  Candidatus Soli...
WP_011684796   7 VPGTLILLVLRVLQT-GP-LHGYAIAQRISQLSSDVLRVEEGSLYPALQKMLMKGWVQSEWEL-SETKRRVRSYRLTAAG 83  Candidatus Soli...
WP_015896658  12 PAGALPLLILRVLQS-ES-LHGYAIAQRIHLLSREVLAVEEGLLYPTLQKMLRKGWVEAEWGI-SETNRKVRFYRLTRPG 88  Acidobacterium ...
WP_011524272  13 fPGALEMMILESLRR-QP-AHGYALVQHIQQRSNNLLQVEEGSLYPALQRLLKGKLVKAEWTVsSSTNRRVRVYEITKAG 90  Candidatus Kori...
WP_011687412  86 RKQLALEEENWARLTEGVARVIG 108 Candidatus Solibacter usitatus
WP_015896654  85 RRQLEVERENWERVTGAVALIVN 107 Acidobacterium capsulatum
WP_011687522  88 RKQLEAEKRDFAFLLAGIARVME 110 Candidatus Solibacter usitatus
WP_011685645  88 RKQLAVETRQYAKLTLAIARVMG 110 Candidatus Solibacter usitatus
WP_011684248  85 LKQLAAETESWKSFSAGVARVLR 107 Candidatus Solibacter usitatus
WP_011688743  85 KKQLAAEEVRWQAVTSAVGRVLR 107 Candidatus Solibacter usitatus
WP_011685338  85 RKLIADQHQAWDRLSAAVDRVLa 107 Candidatus Solibacter usitatus
WP_011684796  84 RKQLAAELAGYDQVNRAIQSVLK 106 Candidatus Solibacter usitatus
WP_015896658  89 RAHLDQELASYGRITKAIQEVLR 111 Acidobacterium capsulatum
WP_011524272  91 LRHLEREISSFDRMLDGIQMVLG 113 Candidatus Koribacter versatilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap