Conserved Protein Domain Family
yjhG_yagF

?
TIGR03432: yjhG_yagF 
putative dehydratase, YjhG/YagF family
This homolog of dihydroxy-acid dehydratases has an odd, sparse distribution. Members are found in two Acidobacteria, two Planctomycetes, Bacillus clausii KSM-K16, and (in two copies each) in strains K12-MG1655 and W3110 of Escherichia coli. The local context is not well conserved, but a few members are adjacent to homologs of the gluconate:H+ symporter (see TIGR00791). [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 163260
View PSSM: TIGR03432
Aligned: 6 rows
Threshold Bit Score: 1139.53
Threshold Setting Gi: 499436025
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012680600  13 LESDSALFASVPTHARGPEGALPITAEMLLTQPSGHLFGLSQNAGMGWEPQRLLDPEFLILSTHGGLRAADGTPIALGFH 92  Acidobacterium ...
WP_011245963   7 FGDEDVSLYNIQTHAKGADGSLPLTSEMLLDSPSGDLFGLSQNVGMGWAPSRLLGKQILILGTQGGIRHENGAPIALGYH 86  Bacillus clausii
WP_000116326   7 FADESHDIYTVRTHADGPDGELPLTAEMLINRPSGDLFGMTMNAGMGWSPDELDRDGILLLSTLGGLRGADGKPVALALH 86  Escherichia
WP_011687047   9 LDSGDRSLFDVRSKAAGPQGAAPITPEMLLLRPSGDLFGWTQNAGMGWDPALLGGKEFLILSTHGGIRAADGTPVALGYH 88  Candidatus Soli...
WP_029601188   6 LDTPE-SAYQLVSTAPGPKGALPLTDDLLRHAPSGDLFGWTQNVGMGWNPALLGGKEFTILSTHGGLRADDGTPIALGFH 84  Gemmata obscuri...
WP_011123489  15 LDAPE----TLATKADGPDGKLPLSDEILRSWTSGDLFGLTQSVGMGFDPRRVLGDQYLILSTQGGVRNPDGTPQALGYH 90  Rhodopirellula ...
WP_012680600  93 TGHWEVGLLVAEAAREFRRWHATPFAGACTDPCDGRTQGTEGMLDSLPYRNDAAMVLGRLMRSLPTRKGVLGIATCDKGL 172 Acidobacterium ...
WP_011245963  87 TGHWEIGLLMKEAAEEIRRQGGVPFAGFVSDPCDGRSQGTTGMFDSLPFRNDAAIVYRRLIRSLPTRRAVIGVATCDKGL 166 Bacillus clausii
WP_000116326  87 QGHYELDIQMKAAAEVIKANHALPYAVYVSDPCDGRTQGTTGMFDSLPYRNDASMVMRRLIRSLPDAKAVIGVASCDKGL 166 Escherichia
WP_011687047  89 TGHWEVALLMDAAAKELKSRGAIPFAAYCTDPCDGRTQGTTGMFDSLPYRNDAAGIFRRLIRSLPTRSGVLGVATCDKGL 168 Candidatus Soli...
WP_029601188  85 SGHWEVGLLVKAAAEEFAKLRCLPFAGAVTDPCDGRTQGTTGMFDSLPYRNDSAQVMRRLMRSHPTRAGVMGIATCDKGL 164 Gemmata obscuri...
WP_011123489  91 TGHWEVGLLGQAAAEQIERDGGVPFAAFVSDPCDGRTQGTHGMFDSLPYRNDAAIVMRRLIRSLPRRKGVIGIATCDKGL 170 Rhodopirellula ...
WP_012680600 173 PAMLMALAASGAHPSVLVPGGVTLLPESSathpaEDAGKVQTIGARFSQGEITQAYAAEVGCRACASPGGGCQFLGTAAT 252 Acidobacterium ...
WP_011245963 167 PAMMVALASMHDLPTIIVPGGVTLPPTNG-----EDAGKIQTIGARYANNEITLQEAADLGCRACATPGGGCQFLGTAGT 241 Bacillus clausii
WP_000116326 167 PATMMALAAQHNIATVLVPGGATLPAKDG-----EDNGKVQTIGARFANGELSLQDARRAGCKACASSGGGCQFLGTAGT 241 Escherichia
WP_011687047 169 PAMMMALAGTRDLPAVLIPGGVTLLPEQG-----EDAGKVQSVGARFSHGQITLEEAAEAMCRSCASPGGGCQFLGTAAT 243 Candidatus Soli...
WP_029601188 165 PAMMMALAAQHHHPTILVPGGVMLAGEAGh----EDTGKVQTIGARYAHGEITLEQAAEAGCHACASPGGGCQFLGTAAT 240 Gemmata obscuri...
WP_011123489 171 PAMMMALAGTGHLANVLVPGGVTLPPTVG-----EDAGKVQTIGARYSRGEMTLEEASVAGCKACGTPGGGCQFLGTAAT 245 Rhodopirellula ...
WP_012680600 253 SQVIAEALGLALPHSALAPSGHEVWLDAATRSARALLRLAQLGMGTRDIVTDAAIRNAMVLHAAFGGSTNLLLHLPAIAH 332 Acidobacterium ...
WP_011245963 242 SQVVAEAMGIALPHSALAPSGQPIWMEMARQSARAALEMEKKGLSTKDIMTDKAIENAMVVHAAFGGSTNLLLHIPAIAH 321 Bacillus clausii
WP_000116326 242 SQVVAEGLGLAIPHSALAPSGEPVWREIARASARAALNLSQKGITTREILTDKAIENAMTVHAAFGGSTNLLLHIPAIAH 321 Escherichia
WP_011687047 244 AQVVGEALGMSLPHSALAPSGHPIWVDMARRSARAALSLESRGLTMSHVLSAASVRNAMVTHAAFGGSTNLILHLPAIAF 323 Candidatus Soli...
WP_029601188 241 SQVVAEALGLTLPHAALAPSGQPIWLDTARRSARALVEMSNRGIRTPDILTEAAFKNALAVFAAFGGSTNLLLHTPAVAF 320 Gemmata obscuri...
WP_011123489 246 SQVIAEALGMTVPHAALAPSGQPIWTRLARDAAATAAAMHASGLSLHEVLTDKAFENAMLMHAAVGGSTNLLLHIPAVAA 325 Rhodopirellula ...
WP_012680600 333 AAGLRRPTVEDWKHINREVPRLVDALPNGPRGYATVQVFLAGAVPETMLHLRRAGLLDTRVRTVTGETLDENLNWWQDSE 412 Acidobacterium ...
WP_011245963 322 AANCKIPTVEDWTRINKKIPRLVDVLPNGPVGHTTVKVFLAGGVPEVMLHLRKLGVLHEDVQTVTGETLGANLDWWEKSE 401 Bacillus clausii
WP_000116326 322 QAGCHIPTVDDWIRINKRVPRLVSVLPNGPVYHPTVNAFMAGGVPEVMLHLRSLGLLHEDVMTVTGSTLKENLDWWEHSE 401 Escherichia
WP_011687047 324 SAGLTRPTVDDWTHVNRQVPRLVDALPNGPKMHPTVQVFLAGGVPEVMLHLRRAGLLDTAALTVTGESLGAMLDWWEQSE 403 Candidatus Soli...
WP_029601188 321 HAGVRRPTIDDWTYFNRKVPRLVDALPNGPMNHPTMRVFLAGGVPEVMLHLRALGLLELDALTVSGEPLGTVLDWWATSE 400 Gemmata obscuri...
WP_011123489 326 AAGRRRPTADDFRRINQSVPRFVDCLPNGPVGHPTVRLFLAGGVPEVAWHLREAGLWNSDEKTVTGMTWNELLDKWQNSE 405 Rhodopirellula ...
WP_012680600 413 RRHSMKQRLQSLDDVDPDDVIFAPGSAKARSIGRTLSFPIGNLAPEGSVIKSTAIDPSLLDGHGNYHHAGPARVFVTEAA 492 Acidobacterium ...
WP_011245963 402 RRALMKKQLLETDGIDPDDIIMDPIKAKERGLTSTVTFPKGNIAPEGSVIKSTSIDPSVVGEDGIYRHTGKAKVFTSEKS 481 Bacillus clausii
WP_000116326 402 RRQRFKQLLLDQEQINADEVIMSPQQAKARGLTSTITFPVGNIAPEGSVIKSTAIDPSMIDEQGIYYHKGVAKVYLSEKS 481 Escherichia
WP_011687047 404 RRASLRRTLRERDGVDPDDVIMDPAGAHRRGLTSTVTFPKGNLAPGGAVIKSTSIDPSVVGEDGVYRMTGPARVFRSEHS 483 Candidatus Soli...
WP_029601188 401 RRTRLRELLRTRDGVDPDTVIMSPEQARQRGLTSTITFPLGNLAPDGCVIKSTAIDPSVVDADGVYRKVGPAKVFIREKD 480 Gemmata obscuri...
WP_011123489 406 RREVCRERLRAADGVDPDEVILPPAIAKERGLTSTVCFPSGNLCPEGSVIKATSIDPTVIDADGVYRKRGRARVFSKESD 485 Rhodopirellula ...
WP_012680600 493 AMDAIKHG---RIGHGDVLVLICGGPMGAGMQETYQVTSALKNLPFCKHVAVLTDARFSGVSTGACLGHISPEALAGGPI 569 Acidobacterium ...
WP_011245963 482 AIKAIKHG---SIEAGDIMVVMGGGPSGTGMEETYQLTSALKHLSYGKHVSLITDARFSGVSTGACIGHIGPEALAGGPI 558 Bacillus clausii
WP_000116326 482 AIYDIKHD---KIKAGDILVIIGVGPSGTGMEETYQVTSALKHLSYGKHVSLITDARFSGVSTGACIGHVGPEALAGGPI 558 Escherichia
WP_011687047 484 AVAAIKSG---EIHAGDVLVLMCRGPLGSGMEEIYQITSALKYLPFGKHVSVITDARFSGVSTGACIGHVTPEALAGGPL 560 Candidatus Soli...
WP_029601188 481 AIKAIKGEgdrKVVPGDVLVLCCRGPLGSGMEETYQVTSALKYLKWGKQVAVITDARFSGVSTGACIGHVSPEALAGGPI 560 Gemmata obscuri...
WP_011123489 486 AIAAVKGQtekPIEAGDVIVLIGRGPIGCGMEETYQITSALKYLSFGKHVALVTDARFSGVSTGACVGHVGPEALAGGPI 565 Rhodopirellula ...
WP_012680600 570 GRVRDGDWIEIRIDGATQEGTVNLIGDDASNSPdhfsppdrftP--EEGARRLAQRSPRADLAPHPALPSHTRLWAALVQ 647 Acidobacterium ...
WP_011245963 559 GKLRDGDMIEIIVDRNELVGSVNFIGTENERLS----------L--ADASQVLKERSLHPDLQPNPDLPDDTRLWAALQS 626 Bacillus clausii
WP_000116326 559 GKLRTGDLIEIKIDCRELHGEVNFLGTRSDEQL----------PsqEEATAILNARPSHQDLLPDPELPDDTRLWAMLQA 628 Escherichia
WP_011687047 561 GKVREGDQIEIVIDRVKLEGTVNLVVDGDAD----------------EGARVLAARPLRDDLAPDPALPPETRLWAMLQD 624 Candidatus Soli...
WP_029601188 561 GKLRDGDLIQIVIDRNKLEGTIDLVGNEIGNYG----------P--LWGSAELAARSARPDLEPDPALPADTRLWAALQH 628 Gemmata obscuri...
WP_011123489 566 GRVRDGDTVEIIIDRNTLDGRVDLVATIDGT----------------DPIKALQTRPIAEGLDRDENIPEDTRLWAALQQ 629 Rhodopirellula ...
WP_012680600 648 ASGGVWGGCVYDTEAIVARL 667 Acidobacterium capsulatum
WP_011245963 627 VSGGTWRGNIYDTDRIIEVL 646 Bacillus clausii
WP_000116326 629 VSGGTWTGCIYDVNKIGAAL 648 Escherichia
WP_011687047 625 ASGGTWAGCVFDVEAIGSRL 644 Candidatus Solibacter usitatus
WP_029601188 629 ASGGVWGGCVYDPGLIAVKL 648 Gemmata obscuriglobus
WP_011123489 630 VGGGSWGGCTYDVDKIIETL 649 Rhodopirellula baltica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap