3I4X


Conserved Protein Domain Family
trp_dimet_allyl

?
TIGR03430: trp_dimet_allyl 
Click on image for an interactive view with Cn3D
tryptophan dimethylallyltransferase
Members of this family are the enzyme tryptophan dimethylallyltransferase (EC 2.5.1.34), a distinct clade within a larger group of aromatic prenyltransferases that may act on on trp-containing cyclic dipeptides, or on tyrosine or other related substrates. Tryptophan dimethylallyltransferase and related enzymes typically are of fungal origin are involved in the biosynthesis of secondary metabolites such as ergot alkaloids.
Statistics
?
PSSM-Id: 132471
View PSSM: TIGR03430
Aligned: 6 rows
Threshold Bit Score: 807.911
Threshold Setting Gi: 90101268
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3I4X_A  17 AYRVLSRAFRFDNEDQKLWWHSTAPMFAKMLETANYTTPCQYQYLITYKECVIPSLGCYPTNSAPRWLSILTRYGTPFEL 96  Aspergillus fumigatus
Q50EL0  11 AYRVLSRAFRFDNEDQKLWWHSTAPMFAKMLETANYTTPCQYQYLITYKECVIPSLGCYPTNSAPRWLSILTRYGTPFEL 90  Aspergillus fumigatus...
Q6X2E0  11 VYEILSLIFDFPSNEQRLWWHSTAPMFAAMLDNAGYNIHDQYRHLGIFKKHIIPFLGVYPTKDKERWLSILTRCGLPLEL 90  ergot fungus
Q6X1E1  11 VYETLSLIFNFPDDTQRLWWHSTAPMLAEMLQTCEYSVHNQYQQLGIFKKHIIPYLGVYPTKSKERWLSILTRYGIPFEL 90  Balansia obtecta
Q6X2E3  11 VYQTLSETFDFANNDQRLWWHSTAPMFQKILQTANYSIYAQYQHLSIYKSHIIPFLGVYPTRSGERWLSILTRYGTPFEL 90  Epichloe typhina x Ne...
Q12594  10 VYDTLSLLFDFPNQEQRLWWHSIAPMFAAMLDTAGHNVHDQYRHLGIFKKHIIPFLGVYPAQGKHTWPSVLTRYGIPFEL 89  Claviceps fusiformis
3I4X_A  97 SLNCSNSIVRYTFEPINQHTGTDKDPFNTHAIWESLQHLLPLEKSIDLEWFRHFKHDLTLNSEESAFLAHNDRLVGGtIR 176 Aspergillus fumigatus
Q50EL0  91 SLNCSNSIVRYTFEPINQHTGTDKDPFNTHAIWESLQHLLPLEKSIDLEWFRHFKHDLTLNSEESAFLAHNDRLVGGtIR 170 Aspergillus fumigatus...
Q6X2E0  91 SLNCTDSVVRYTYEPINEVTGTEKDTFNTLAIMTSVQKLAQIQAGIDLEWFSYFKDELTLDESESATLQSNELVKEQ-IK 169 ergot fungus
Q6X1E1  91 SLNCSDSVVRYTYEPINEATGTEKDPYNTLAILDSAQELIRIQAGIDLEWFTYFKDELTVNMTESEYLRSNGLVNCQ-IK 169 Balansia obtecta
Q6X2E3  91 SLNCSDSIVRYTYEPINAATGSHLDPFNTFAIWEALKKLIDSQPGIDLQWFSYFKQELTLDANESTYLHSQNLVKEQ-IK 169 Epichloe typhina x Ne...
Q12594  90 SLNCLDSVVRYTFEPTTEHTGTGDDSYNAFAILECIQKLVRIQPGIDMEWFSYFRNELVLNATESARLGRNDSVNQQpIR 169 Claviceps fusiformis
3I4X_A 177 TQNKLALDLKDGRFALKTYIYPALKAVVTGKTIHELVFGSVRRLAVREPRILPPLNMLEEYIRSRG---------SKSTA 247 Aspergillus fumigatus
Q50EL0 171 TQNKLALDLKDGRFALKTYIYPALKAVVTGKTIHELVFGSVRRLAVREPRILPPLNMLEEYIRSRG---------SKSTA 241 Aspergillus fumigatus...
Q6X2E0 170 TQNKLALDLKESQFALKVYFYPHLKSIATGKSTHDLIFDSVLKLSQKHDSIQPAFQVLCDYVSRRNhsa----evDQHGA 245 ergot fungus
Q6X1E1 170 TQNKLALDLKGDQFTLKVYMYPELKSVATGKSLHELIFGSVRRLSLKYNSIRAPLDMLDDYVTSRNmga----ngEEHLP 245 Balansia obtecta
Q6X2E3 170 TQNKLALDLKGDKFVLKTYIYPELKSVATGKSVQELVFGSVRKLAQKHKSIRPAFEMLEDYVQSRNkvpt--tddSHNTP 247 Epichloe typhina x Ne...
Q12594 170 TQNKLALDLKGDRFALKVYLYPHLKSIATGVSSHDLIFNSVRKLSQKHTSIQPSFNVLCDYVASRNdpdsnaaeaEAGVP 249 Claviceps fusiformis
3I4X_A 248 ----SPRLVSCDLTSPAKSRIKIYLLEQMVSLEAMEDLWTLGGRRRDASTLEGLSLVRELWDLIQLSPGLKSYPAPYLPL 323 Aspergillus fumigatus
Q50EL0 242 ----SPRLVSCDLTSPAKSRIKIYLLEQMVSLEAMEDLWTLGGRRRDASTLEGLSLVRELWDLIQLSPGLKSYPAPYLPL 317 Aspergillus fumigatus...
Q6X2E0 246 l---HARLLSCDLIDPAKSRVKIYLLEKTVSLSVMEDLWTLGGQRVDASTMDGLDMLRELWSLLKVPTGHLEYPKGYLEL 322 ergot fungus
Q6X1E1 246 l---EPRLLSCDLMDPHKSRVKIYLHERKVSLSAMEDLWTLGGRRTDSTTMDGLNMVRELWDLLEIPTCLQKYPAPFLEL 322 Balansia obtecta
Q6X2E3 248 l---SSRLLSCDLVSPTKSRVKIYLLERMVSLPAMEDLWTLGGRREDQSTIEGLEMIRELWGLLNMSPGLRAYPEPYLPL 324 Epichloe typhina x Ne...
Q12594 250 asalRARLLSCDLVDPSKSRIKIYLLEQTVSLTAMEDLWTLGGRRTDSSTLNGLDMMRELWHLLQIPSGFMKYPESDLKL 329 Claviceps fusiformis
3I4X_A 324 GVIPDERLPLMANFTLHQNDPVPEPQVYFTTFGMNDMAVADALTTFFERRGWSEMARTYETTLKSYYPHADHDKLNYLHA 403 Aspergillus fumigatus
Q50EL0 318 GVIPDERLPLMANFTLHQNDPVPEPQVYFTTFGMNDMAVADALTTFFERRGWSEMARTYETTLKSYYPHADHDKLNYLHA 397 Aspergillus fumigatus...
Q6X2E0 323 GEIPNEQLPSMANYTLHHNDPMPEPQVYFTVFGMNDAEISNALTIFFQRHGFDDMAKNYRVFLQDSYPYHDFESLNYLHA 402 ergot fungus
Q6X1E1 323 GQIPREQLPSMANYTLHHGDPMPEPQVYFTVFGMNDSKVISALTEFFKRRVWNGMARKYRAFLQNSYPNDDHESLNYLHT 402 Balansia obtecta
Q6X2E3 325 GAIPNEQLPSMANYTLHHNDPIPEPQVYFTVFGMNDMEVTNALTKFFMRHEWSDMASKYKACLRESFPHHNYEALNYIHS 404 Epichloe typhina x Ne...
Q12594 330 GEVPDEQLPSMVHYALHPDQPMPEPQVYFTVFGMSDAGITNALATFFSRHGWYEMAKKYRVFLEGSFPNHDFESLNYLHT 409 Claviceps fusiformis
3I4X_A 404 YISFSYRDRTPYLSVYLQSFETGDWAV 430 Aspergillus fumigatus
Q50EL0 398 YISFSYRDRTPYLSVYLQSFETGDWAV 424 Aspergillus fumigatus Af293
Q6X2E0 403 YISFSYRRNKPYLSVYLHTFETGRWPV 429 ergot fungus
Q6X1E1 403 YISFSYRKNKPYLSVYLHTFESGSWPI 429 Balansia obtecta
Q6X2E3 405 YISFSYRNNKPYLSVYLHSFETGEWPV 431 Epichloe typhina x Neotyphodium lolii
Q12594 410 YVSFSYRKNKPYLSVYLHSFETGQWPA 436 Claviceps fusiformis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap